DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr8

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:217 Identity:55/217 - (25%)
Similarity:92/217 - (42%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 SNAAAKVNYTAELQVRVAPRWRYEPMDTAI------MLGNTISINCEAEGYPIPTITWFK----- 763
            ::.|:|..:|..||....|.......||.|      ::|.|:.:.|..:.....|::|.:     
  Fly    19 TDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIH 83

  Fly   764 ----GQGKGSKDFKPLSMRN-H----SLLLNLATDNDEGYYMCQ--ATNEIGAGLKKTIRINVNE 817
                |:...:.|.:..:|.: |    :|.:..|...|.|.|.||  .|..||    .::.:|:.|
  Fly    84 LLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIG----HSVYLNIVE 144

  Fly   818 PARFEQSARNISSRRNDPVTLDCHAK--GDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGV--D 878
            |.........:...|...:.|.|..|  .:.|.|:.|:.|...|:.::.|..|: :.|||||  .
  Fly   145 PVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGIS-LVTEKGVLTT 208

  Fly   879 SQLTIGHSDRHDSGVYRCIAEN 900
            |:|.:..:...|||:|.|...|
  Fly   209 SRLLVQKAITQDSGLYTCTPSN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 4/13 (31%)
ig 645..712 CDD:278476 0/1 (0%)
IG_like 734..815 CDD:214653 22/102 (22%)
Ig 745..815 CDD:299845 17/85 (20%)
I-set 820..913 CDD:254352 24/85 (28%)
Ig 838..920 CDD:299845 23/67 (34%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 16/79 (20%)
V-set 52..143 CDD:284989 20/94 (21%)
IG_like 153..238 CDD:214653 24/79 (30%)
ig 153..232 CDD:278476 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.