| Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 59/252 - (23%) |
|---|---|---|---|
| Similarity: | 94/252 - (37%) | Gaps: | 62/252 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 305 LLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANFNCTTTGSAI 369
Fly 370 DAIDWLH---NGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRA------- 424
Fly 425 -----SAQAMAELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSL 484
Fly 485 HHRFAIGQFVDMSGDVI------SHLNISHVRPDDGGLYKCVASNSMGSVQHSARLN 535 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
| Ig | 56..125 | CDD:143165 | |||
| I-set | 246..337 | CDD:254352 | 9/31 (29%) | ||
| Ig | 264..334 | CDD:143165 | 8/28 (29%) | ||
| I-set | 345..433 | CDD:254352 | 20/102 (20%) | ||
| Ig | 358..431 | CDD:143165 | 17/87 (20%) | ||
| Ig | 456..533 | CDD:143165 | 22/82 (27%) | ||
| IGc2 | 553..619 | CDD:197706 | |||
| I-set | 634..724 | CDD:254352 | |||
| ig | 645..712 | CDD:278476 | |||
| IG_like | 734..815 | CDD:214653 | |||
| Ig | 745..815 | CDD:299845 | |||
| I-set | 820..913 | CDD:254352 | |||
| Ig | 838..920 | CDD:299845 | |||
| FN3 | 917..1033 | CDD:238020 | |||
| FN3 | 1040..1142 | CDD:238020 | |||
| fn3 | 1150..1237 | CDD:278470 | |||
| FN3 | 1263..1345 | CDD:238020 | |||
| Ig | 1350..1436 | CDD:299845 | |||
| IG_like | 1358..1436 | CDD:214653 | |||
| FN3 | 1441..1530 | CDD:238020 | |||
| FN3 | 1542..1620 | CDD:238020 | |||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | |
| Ig strand A' | 40..46 | CDD:409353 | |||
| IG_like | 41..129 | CDD:214653 | 9/31 (29%) | ||
| Ig strand B | 48..56 | CDD:409353 | |||
| CDR1 | 56..60 | CDD:409353 | |||
| FR2 | 61..68 | CDD:409353 | |||
| Ig strand C | 61..67 | CDD:409353 | |||
| CDR2 | 69..79 | CDD:409353 | |||
| Ig strand C' | 71..74 | CDD:409353 | |||
| Ig strand C' | 76..79 | CDD:409353 | |||
| FR3 | 80..115 | CDD:409353 | 7/17 (41%) | ||
| Ig strand D | 84..91 | CDD:409353 | |||
| Ig strand E | 94..100 | CDD:409353 | 1/2 (50%) | ||
| Ig strand F | 107..115 | CDD:409353 | 2/7 (29%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 17/72 (24%) | ||
| Ig strand B | 150..157 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 1/10 (10%) | ||
| Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
| Ig_3 | 219..295 | CDD:404760 | 25/101 (25%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 248..252 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||