DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:586 Identity:132/586 - (22%)
Similarity:205/586 - (34%) Gaps:172/586 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 RDAGKWICQASNQFGEQRIEIRLSVNSYVSVH--ILPQVQIVNSGGTANFNCTTTGSAIDAIDW- 374
            ||| ...|...|..|.:...:|:...:.:|:|  ::.|    ||..:..:|        |...| 
  Fly    89 RDA-LMACVVENLKGYKVAWVRVDTQTILSIHHNVISQ----NSRISLTYN--------DHRSWY 140

  Fly   375 LHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAELK--LGDT 437
            ||                           ::.|...|||.|.|.|     :...|...|  |...
  Fly   141 LH---------------------------IKEVEETDRGWYMCQV-----NTDPMRSRKGYLQVV 173

  Fly   438 VPELIYTFIEQN---VRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVD-MSG 498
            ||.:|...:..|   ||.|..|||.|.|.|.|.|...|..:....|.:.       |:.|: :.|
  Fly   174 VPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIG-------GEHVNVVDG 231

  Fly   499 DVISHLNISHVRPDDGGLYKCVASNSM-GSVQHSARLNVYGPPYVRAIGPIK-AVAGEDIIVHCP 561
            :::....:|.:..   ..|.|||||.: .|:.....|.|..||.:.....:: |..|:|:|:.|.
  Fly   232 ELLHITKVSRLHM---AAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECH 293

  Fly   562 FAGYPVEQIRWEKAHQELTTS------NHYELASVADG----GQLVIKNVEPGRDQGIYTCIVRS 616
            ...||.....|.....::..|      :.||..|...|    .:|.|:.|.| .|.|.|.|:.::
  Fly   294 TEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGP-NDFGTYRCVAKN 357

  Fly   617 RAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQI 681
            ..||                                     :.|::      |.|:...|::..|
  Fly   358 SLGE-------------------------------------TDGNI------KLDEMPTPTTAII 379

  Fly   682 TEKKEEFYSLLVFK-DISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTI 745
            :|     .|||... |...||..|:    .:|.|..:|..|       .||    |.|  .||..
  Fly   380 SE-----MSLLNRSYDGKRRHRNKF----DSANALPDYGVE-------EWR----DGA--QGNNA 422

  Fly   746 SINCEAEGYPI--PTITWFKGQGKGSKDFKPLSMRNHSLL----LNLATDNDEGYYMCQATNEIG 804
            ..|.:....|:  |...:....|         |:..|:||    |.:.|.:...:....::..:.
  Fly   423 GNNGDNNQTPVRNPPGAFHNSAG---------SLAQHNLLAKIMLGIKTQSFGIFKRLSSSLPLA 478

  Fly   805 AGLK----KTIRINVNEPARFEQSARNISSRRNDPVTL-------DCHAKGDEPITIGWTQNNGR 858
            ||..    .|:.: |:.|:|:..|  |:.:|.|.|.|:       :|.......::.....||.|
  Fly   479 AGQSFLWLSTLSL-VSAPSRWRMS--NVENRPNSPETVVNNDTAAECWETRSHCVSESNNNNNSR 540

  Fly   859 I 859
            |
  Fly   541 I 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 7/23 (30%)
Ig 264..334 CDD:143165 6/20 (30%)
I-set 345..433 CDD:254352 16/88 (18%)
Ig 358..431 CDD:143165 13/73 (18%)
Ig 456..533 CDD:143165 21/78 (27%)
IGc2 553..619 CDD:197706 20/75 (27%)
I-set 634..724 CDD:254352 17/90 (19%)
ig 645..712 CDD:278476 13/67 (19%)
IG_like 734..815 CDD:214653 17/90 (19%)
Ig 745..815 CDD:299845 13/79 (16%)
I-set 820..913 CDD:254352 12/47 (26%)
Ig 838..920 CDD:299845 5/29 (17%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 27/127 (21%)
IG_like 82..174 CDD:214653 27/129 (21%)
IG_like 184..267 CDD:214653 26/92 (28%)
IGc2 191..255 CDD:197706 21/73 (29%)
IG_like 282..368 CDD:214653 24/129 (19%)
Ig 288..367 CDD:143165 21/122 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.