DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Kirrel3

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:791 Identity:175/791 - (22%)
Similarity:301/791 - (38%) Gaps:144/791 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 LLVQNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQN----VRPGPLISLKCSA 462
            |..|.:|.:.||.  |||...      ||:.|........:|:|.:|.    |..|..::|.|:.
  Rat    15 LFSQELGLQRRGC--CLVLGY------MAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAI 71

  Fly   463 SGSPPPQF----AWLLDSQPI---MDVSLHHRF-AIGQFVDMSGDVISHLNISHVRPDDGGLYKC 519
                 |::    .|:.|...:   .|:|.:.:: .:|.  .:||:  .||.|......|..:|:|
  Rat    72 -----PEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGN--HLSGE--HHLKILRAELQDDAVYEC 127

  Fly   520 VASNSMGSVQHSARLNVYGPPYVRAI--GPIKAV-AGEDIIVHC-PFAGYPVEQIRWEKAHQELT 580
            .|..: ......|||.|..||....|  ||:.:: ||:.:.:.| .....|...|.|.: ..|:.
  Rat   128 QAIQA-AIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLR-KGEVI 190

  Fly   581 TSNHYELASVADGGQLVIKN---VEPG---RDQGIYTCIVRSRA---GEEARRDMQLNVNSPPVI 636
            ....|....:.||.:..|.:   :.||   ..|.| .|...::|   |:|.  .:.:::..||::
  Rat   191 NGATYSKTLLRDGKRESIVSTLFISPGDVENGQSI-VCRATNKAIPGGKET--SVTIDIQHPPLV 252

  Fly   637 EPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFKDISARH 701
            .....|:.:.|.......|:..:......:.|.|....      |.|...|.|...|  |.: ..
  Rat   253 NLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHI------IKEASGELYRTTV--DYT-YF 308

  Fly   702 SGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTITWFK-GQ 765
            |...:|..:||....|.:..:.|...||...||....:.||:....:|...|.|..||.|.| |.
  Rat   309 SEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGS 373

  Fly   766 GKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQA-TNEIGAGLKKTIRINVNEPARFEQSARNIS 829
            |....:.|.|::::       ....|.|.|:|:| ...:||| ::.:.:.||.|. ...|.:...
  Rat   374 GVVLSNEKTLTLKS-------VRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPP-IISSTQTQH 429

  Fly   830 SRRNDPVTLDCHAKGDEP---ITIGWTQN---NGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDR 888
            :...:...:.|..:...|   |...|.:|   :|    .:.|:::..:.||:||.|.|||.:..|
  Rat   430 ALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESG----TSGRYTVETVNTEEGVISTLTISNIVR 490

  Fly   889 HD-SGVYRCIAENPYGRAEQIIFLAVQ----------ERPDTPSHLEI-FEVGSRTVKLSWRRPF 941
            .| ..:|.|.|.|.:|...:||.|..|          |....|..:.| ..||:....|      
  Rat   491 ADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFL------ 549

  Fly   942 DGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISR---SYDSDLRESAIVAG 1003
                .:::.:|.:...:..:|.|......|........:.||..:..:   |..:|:|..  :..
  Rat   550 ----VLMATIVAFCCARSQRSTGGRPGISGRGTEQKARLRLPRRANLKGVVSAKNDIRVE--IVH 608

  Fly  1004 LTPA--------TTFLIRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNVQVQTGGESELIVTWQ 1060
            ..||        ||....|....|.::.:..:.:.:..:||...:   |::..|.|.        
  Rat   609 KEPASGREAEDHTTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQ---NLKDPTNGY-------- 662

  Fly  1061 IPPRESWNGELIGYTVNCSEEKQNINFISV------VNSSLKSTIVSGWATTK--ATLRGLRKYS 1117
                         |:||..:|..:...||:      :..:.|..:.:|.:.|.  :||.|..:..
  Rat   663 -------------YSVNTFKEHHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYSTLSGQGRLY 714

  Fly  1118 RYAVTIRAMNS 1128
            .|..::.|.::
  Rat   715 DYGQSVTAASA 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 10/30 (33%)
Ig 358..431 CDD:143165 9/28 (32%)
Ig 456..533 CDD:143165 17/84 (20%)
IGc2 553..619 CDD:197706 16/75 (21%)
I-set 634..724 CDD:254352 17/89 (19%)
ig 645..712 CDD:278476 12/66 (18%)
IG_like 734..815 CDD:214653 22/82 (27%)
Ig 745..815 CDD:299845 19/71 (27%)
I-set 820..913 CDD:254352 26/99 (26%)
Ig 838..920 CDD:299845 27/98 (28%)
FN3 917..1033 CDD:238020 20/127 (16%)
FN3 1040..1142 CDD:238020 17/97 (18%)
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 22/98 (22%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 0/3 (0%)
Ig strand E 104..116 CDD:409353 5/15 (33%)
Ig strand G 132..143 CDD:409353 3/11 (27%)
IgI_2_KIRREL3-like 149..246 CDD:409416 22/100 (22%)
Ig strand B 166..170 CDD:409416 0/3 (0%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 2/5 (40%)
Ig strand G 239..242 CDD:409416 1/4 (25%)
Ig <267..334 CDD:416386 15/75 (20%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 0/8 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 1/6 (17%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 25/88 (28%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 26/101 (26%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 2/3 (67%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.