Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
Alignment Length: | 346 | Identity: | 77/346 - (22%) |
---|---|---|---|
Similarity: | 131/346 - (37%) | Gaps: | 61/346 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 631 NSPPV---IEPFKFPK---------------NLQEGGRAQITCAVSSGDMPIYFSWKK------- 670
Fly 671 --DDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYE 733
Fly 734 PMDTAIMLGNTISINCEAEGYPIPTITW---------FKGQGKGSKDFKPLSMRNHSLLLNLATD 789
Fly 790 NDEGYYMCQATNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQ 854
Fly 855 NNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDT 919
Fly 920 PSHLEIFEVGSRTVKLSWRRP 940 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
Ig | 56..125 | CDD:143165 | |||
I-set | 246..337 | CDD:254352 | |||
Ig | 264..334 | CDD:143165 | |||
I-set | 345..433 | CDD:254352 | |||
Ig | 358..431 | CDD:143165 | |||
Ig | 456..533 | CDD:143165 | |||
IGc2 | 553..619 | CDD:197706 | |||
I-set | 634..724 | CDD:254352 | 19/116 (16%) | ||
ig | 645..712 | CDD:278476 | 15/75 (20%) | ||
IG_like | 734..815 | CDD:214653 | 21/89 (24%) | ||
Ig | 745..815 | CDD:299845 | 19/78 (24%) | ||
I-set | 820..913 | CDD:254352 | 22/92 (24%) | ||
Ig | 838..920 | CDD:299845 | 21/81 (26%) | ||
FN3 | 917..1033 | CDD:238020 | 7/24 (29%) | ||
FN3 | 1040..1142 | CDD:238020 | |||
fn3 | 1150..1237 | CDD:278470 | |||
FN3 | 1263..1345 | CDD:238020 | |||
Ig | 1350..1436 | CDD:299845 | |||
IG_like | 1358..1436 | CDD:214653 | |||
FN3 | 1441..1530 | CDD:238020 | |||
FN3 | 1542..1620 | CDD:238020 | |||
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 16/92 (17%) |
FR1 | 55..71 | CDD:409353 | 2/15 (13%) | ||
Ig strand A' | 56..62 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 64..72 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 72..76 | CDD:409353 | 1/3 (33%) | ||
FR2 | 77..84 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 77..83 | CDD:409353 | 1/7 (14%) | ||
CDR2 | 85..95 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 87..90 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 92..95 | CDD:409353 | 1/2 (50%) | ||
FR3 | 96..131 | CDD:409353 | 9/35 (26%) | ||
Ig strand D | 100..107 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 110..116 | CDD:409353 | 3/5 (60%) | ||
Ig strand F | 123..131 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 132..136 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 136..145 | CDD:409353 | 1/8 (13%) | ||
FR4 | 138..145 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 148..218 | CDD:404760 | 19/82 (23%) | ||
Ig strand A' | 155..160 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 166..173 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 179..184 | CDD:409353 | 3/4 (75%) | ||
Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 197..203 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 224..232 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 235..311 | CDD:404760 | 20/81 (25%) | ||
Ig strand B | 252..256 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 304..309 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 318..321 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |