DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Psg29

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001020812.1 Gene:Psg29 / 292666 RGDID:1565741 Length:468 Species:Rattus norvegicus


Alignment Length:534 Identity:112/534 - (20%)
Similarity:175/534 - (32%) Gaps:170/534 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 LSVNSYVSVHILPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTT-------GRD 392
            ||..|.|::.::|. |:| .|....|........:....|....|.::...||.|       ..|
  Rat    30 LSTTSQVTIELMPP-QVV-EGEDVLFLVHNLPENVTTFVWFKGRKNMKRGIALYTVASDLLVHSD 92

  Fly   393 NIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQNVRPGPLIS 457
            .....|..||::.|:.::||..|.....|:|:...:...            ||:..||       
  Rat    93 RETLYSNGSLMIHNITQKDREYYTLRTFNKRSETVSTTS------------TFLHVNV------- 138

  Fly   458 LKCSASGSPPPQFAW-----LLDSQPIMD-----------VSLH-HRFA--IGQFVDMSG-DVIS 502
                        |.|     :..||||::           |:|| |:..  |..|:...| .|..
  Rat   139 ------------FLWNCGRLVTSSQPIIESLPHIVPEGHHVALHVHKIPENIQGFIWFKGMTVFR 191

  Fly   503 HLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVAGEDIIVHCPFAGYPV 567
            ||.|  ||      ||.           |::.:|:||.|          :|.:            
  Rat   192 HLEI--VR------YKM-----------SSKSSVFGPAY----------SGRE------------ 215

  Fly   568 EQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIV--RSRAGEEARRDMQLNV 630
                                 ::...|.|:|:||.. .|.|:||..|  .....|||..::::..
  Rat   216 ---------------------TLNSDGALLIENVTQ-TDAGLYTLRVLGTDMKSEEAHVEIRVEK 258

  Fly   631 NSPPVIEPFKFPKNLQEG-------GRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQI------- 681
            .|.....|....|.:.|.       |.:.:....:.....|.|:|......: |:.||       
  Rat   259 PSFQCCNPITSSKFMVEAVPRYAAKGESVLLLVHNLPKELISFTWYNSMYRV-SAFQIVNYHVIW 322

  Fly   682 ------TEKKEE--FYS--LLVFKDISARHSGKYTCYASNAAAKVNYTAE---LQVRVAPRWRYE 733
                  .|.:|.  .|:  .|:.:|::...|..||....|    ||||.|   :|..|.     :
  Rat   323 NITTWGNEYRERGMVYANGSLLLQDVTEEDSRMYTLETLN----VNYTVERAHVQFYVT-----K 378

  Fly   734 PM--------DTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLATDN 790
            |:        ||.:....:::..|......|||:..|........:...:|.....|.::.....
  Rat   379 PVTQPFVRITDTTVNAHRSVTFTCITPDVGIPTLWLFNNHNLQVTERIKMSPTKCGLRIDNVRSE 443

  Fly   791 DEGYYMCQATNEIG 804
            |.|.|.|..||..|
  Rat   444 DAGEYQCMVTNRAG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 1/1 (100%)
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 20/94 (21%)
Ig 358..431 CDD:143165 16/79 (20%)
Ig 456..533 CDD:143165 22/96 (23%)
IGc2 553..619 CDD:197706 11/67 (16%)
I-set 634..724 CDD:254352 24/116 (21%)
ig 645..712 CDD:278476 16/90 (18%)
IG_like 734..815 CDD:214653 17/79 (22%)
Ig 745..815 CDD:299845 14/60 (23%)
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Psg29NP_001020812.1 Ig_CEACAM_D1 36..136 CDD:143251 23/113 (20%)
Ig_CEACAM_D1 152..256 CDD:143251 36/166 (22%)
Ig 272..376 CDD:299845 23/108 (21%)
IG_like 389..462 CDD:214653 16/69 (23%)
IGc2 396..457 CDD:197706 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.