DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and dpr9

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:331 Identity:74/331 - (22%)
Similarity:118/331 - (35%) Gaps:96/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATQVPG-----LRKISGNGTLHFPPFLAQ-YYRT--DVHEATYRCRASNEAGTVLSRNVQVHAVV 136
            ||.:.|     |.|.|...:..|...||. ::|.  |:.||       ..||....:        
  Fly   211 ATTITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEA-------RNAGPYFDK-------- 260

  Fly   137 RRQFHVHVENTEVYLGNSALIKCAIPEY-VRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGD 200
                 ...:|....||.:|.:.|.:... .:..:...||.|..:|.|.    ..|||...:....
  Fly   261 -----AFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLL----TVGRYTYTSDQRF 316

  Fly   201 LYVRSVRSEDGLMK-----------FSCLVTNTLNGERQRSDAVMLQVKELSKNL--APRTTQKP 252
            ..:...::||.:::           :.|.|:.|    ...|..:.|.|.|.|..:  ||      
  Fly   317 RAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTT----PHMSHYIHLNVVEPSTEIIGAP------ 371

  Fly   253 VMEIHVERGNDVHLPCNIQGNPFP---IFTWYRVSDSAALYPIPSSQRVI--------------- 299
              ::::|.|:.::|.|.||.:|.|   || |...:      ..||..::|               
  Fly   372 --DLYIESGSTINLTCIIQNSPEPPAYIF-WNHNN------AFPSHPQIINYDSPRGGVSVVTNK 427

  Fly   300 --LSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANFNC 362
              .:.:.||||:|...|:|.:.|..||           :....|:||:|..|....|.|..:.|.
  Fly   428 GDTTTSFLLIKSARPSDSGHYQCNPSN-----------AKPKSVTVHVLNGVSHSVSRGVPSSNA 481

  Fly   363 TTTGSA 368
            ....||
  Fly   482 ARGTSA 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652 15/60 (25%)
Ig 56..125 CDD:143165 15/52 (29%)
I-set 246..337 CDD:254352 25/110 (23%)
Ig 264..334 CDD:143165 22/89 (25%)
I-set 345..433 CDD:254352 7/24 (29%)
Ig 358..431 CDD:143165 3/11 (27%)
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
dpr9NP_001287332.1 Ig 263..361 CDD:299845 20/105 (19%)
IG_like 263..360 CDD:214653 20/104 (19%)
IG_like 371..464 CDD:214653 27/118 (23%)
IGc2 377..456 CDD:197706 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.