| Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_776169.2 | Gene: | NEGR1 / 257194 | HGNCID: | 17302 | Length: | 354 | Species: | Homo sapiens |
| Alignment Length: | 266 | Identity: | 65/266 - (24%) |
|---|---|---|---|
| Similarity: | 104/266 - (39%) | Gaps: | 46/266 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 305 LLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANFNCTTTGSAI 369
Fly 370 DAIDWLH---NGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAE 431
Fly 432 LKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDM 496
Fly 497 SGDVI------SHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVAGE- 554
Fly 555 DIIVHC 560 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
| Ig | 56..125 | CDD:143165 | |||
| I-set | 246..337 | CDD:254352 | 9/31 (29%) | ||
| Ig | 264..334 | CDD:143165 | 8/28 (29%) | ||
| I-set | 345..433 | CDD:254352 | 20/90 (22%) | ||
| Ig | 358..431 | CDD:143165 | 17/75 (23%) | ||
| Ig | 456..533 | CDD:143165 | 22/82 (27%) | ||
| IGc2 | 553..619 | CDD:197706 | 3/9 (33%) | ||
| I-set | 634..724 | CDD:254352 | |||
| ig | 645..712 | CDD:278476 | |||
| IG_like | 734..815 | CDD:214653 | |||
| Ig | 745..815 | CDD:299845 | |||
| I-set | 820..913 | CDD:254352 | |||
| Ig | 838..920 | CDD:299845 | |||
| FN3 | 917..1033 | CDD:238020 | |||
| FN3 | 1040..1142 | CDD:238020 | |||
| fn3 | 1150..1237 | CDD:278470 | |||
| FN3 | 1263..1345 | CDD:238020 | |||
| Ig | 1350..1436 | CDD:299845 | |||
| IG_like | 1358..1436 | CDD:214653 | |||
| FN3 | 1441..1530 | CDD:238020 | |||
| FN3 | 1542..1620 | CDD:238020 | |||
| NEGR1 | NP_776169.2 | IG | 47..135 | CDD:214652 | 9/31 (29%) |
| IGc2 | 152..210 | CDD:197706 | 17/73 (23%) | ||
| Ig_3 | 225..301 | CDD:372822 | 23/88 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||