DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Iglon5

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:441 Identity:84/441 - (19%)
Similarity:131/441 - (29%) Gaps:167/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 RVSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHIL 346
            |:..:|||..:....|.:||::|.....||...    :|:..|          .:::.::..|  
Mouse    11 RLLAAAALAGLAVISRGLLSQSLEFSSPADNYT----VCEGDN----------ATLSCFIDEH-- 59

  Fly   347 PQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFL----SKSSLLVQNV 407
                                  :..:.||:....|.|.|...|....:|.|    .:.|:|:..|
Mouse    60 ----------------------VTRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQV 102

  Fly   408 GRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQ-NVRPGPLISLKCSASGSPPPQFA 471
            |..|.|:|.|..:.:.........|.:  .||..|...... .|..|..::|.|.|.|.|.|...
Mouse   103 GLGDEGLYTCSFQTRHQPYTTQVYLIV--HVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVT 165

  Fly   472 WLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSAR--L 534
            |.         .|...|.      ..|::   |.||.::....|.|:||..|.:.|...|.|  :
Mouse   166 WR---------QLRDGFT------SEGEI---LEISDIQRGQAGEYECVTHNGVNSAPDSRRVLV 212

  Fly   535 NVYGPPYVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIK 599
            .|..||.:..:...:...|...::.|.....|                                 
Mouse   213 TVNYPPTITDVTSARTALGRAALLRCEAMAVP--------------------------------- 244

  Fly   600 NVEPGRDQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPI 664
                                                                           |.
Mouse   245 ---------------------------------------------------------------PA 246

  Fly   665 YFSWKKDDSSIPS----SLQITEKKEEFYSLLVFKDISARHSGKYTCYASN 711
            .|.|.|||..:.|    .|::  :.|...|:|:|.::||||.|.|||.|:|
Mouse   247 DFQWYKDDRLLSSGSAEGLKV--QTERTRSMLLFANVSARHYGNYTCRAAN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 12/54 (22%)
Ig 264..334 CDD:143165 12/51 (24%)
I-set 345..433 CDD:254352 16/91 (18%)
Ig 358..431 CDD:143165 16/76 (21%)
Ig 456..533 CDD:143165 20/76 (26%)
IGc2 553..619 CDD:197706 3/65 (5%)
I-set 634..724 CDD:254352 22/82 (27%)
ig 645..712 CDD:278476 22/71 (31%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 20/125 (16%)
Ig strand A' 41..46 CDD:409353 0/8 (0%)
Ig strand B 48..56 CDD:409353 1/17 (6%)
CDR1 56..60 CDD:409353 1/27 (4%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 1/5 (20%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 11/34 (32%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 2/5 (40%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 20/82 (24%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 0/8 (0%)
Ig strand E 178..183 CDD:409353 1/7 (14%)
Ig strand F 191..199 CDD:409353 4/7 (57%)
Ig_3 217..295 CDD:404760 26/175 (15%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.