DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and zig-2

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:218 Identity:54/218 - (24%)
Similarity:85/218 - (38%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 NQRASAQAMAELKLGDTVPELIYTFI--EQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVS 483
            |...|......::..|:.|.|.:|..  :.||..|....|.|.|:|:|.|...|.|:...|....
 Worm    13 NAAESVDHQKPIRALDSQPLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEE 77

  Fly   484 LHHRFA----IGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSAR----------- 533
            ..:.:.    .|:.|..:..|.||..|......:.|.|||:..|.:..::|.|:           
 Worm    78 TSNVYENILNDGKQVSNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCA 142

  Fly   534 LNVYGPPYVRAIGPIK-AVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLV 597
            ||..|.|::......: .::...:.:.|  ......:..|.|..|.||  |..|...:...|.|:
 Worm   143 LNDNGAPFISMTVDFRLEISNNAVALSC--RSETATEWSWHKGEQLLT--NDGERYQMFPSGDLI 203

  Fly   598 IKNVEPGRDQGIYTCIVRSRAGE 620
            |:|:. ..|.|.|.|..|:..||
 Worm   204 IRNIS-WSDMGEYNCTARNHFGE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 2/11 (18%)
Ig 358..431 CDD:143165 2/9 (22%)
Ig 456..533 CDD:143165 21/80 (26%)
IGc2 553..619 CDD:197706 17/65 (26%)
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 26/99 (26%)
Ig 34..121 CDD:299845 23/86 (27%)
Ig <179..232 CDD:299845 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.