| Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499714.1 | Gene: | zig-8 / 176732 | WormBaseID: | WBGene00006985 | Length: | 268 | Species: | Caenorhabditis elegans |
| Alignment Length: | 229 | Identity: | 54/229 - (23%) |
|---|---|---|---|
| Similarity: | 99/229 - (43%) | Gaps: | 30/229 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 708 YASNAAAKVNYTAELQVRVAPRWRYE-PMDTA--IMLGNTISINCEAEGYPIPTITWFK-GQG-- 766
Fly 767 --KGSKDFK-----PLSMRNHSL-LLNL--ATDNDEGYYMCQAT---NEIGAGLKKTIRINVNEP 818
Fly 819 ARFE-QSARNISSRRNDPVTLDCHA----KGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVD 878
Fly 879 SQ-LTIGHSDRHDSGVYRCIAENPYGRAEQIIFL 911 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
| Ig | 56..125 | CDD:143165 | |||
| I-set | 246..337 | CDD:254352 | |||
| Ig | 264..334 | CDD:143165 | |||
| I-set | 345..433 | CDD:254352 | |||
| Ig | 358..431 | CDD:143165 | |||
| Ig | 456..533 | CDD:143165 | |||
| IGc2 | 553..619 | CDD:197706 | |||
| I-set | 634..724 | CDD:254352 | 5/15 (33%) | ||
| ig | 645..712 | CDD:278476 | 2/3 (67%) | ||
| IG_like | 734..815 | CDD:214653 | 21/98 (21%) | ||
| Ig | 745..815 | CDD:299845 | 18/85 (21%) | ||
| I-set | 820..913 | CDD:254352 | 24/98 (24%) | ||
| Ig | 838..920 | CDD:299845 | 21/79 (27%) | ||
| FN3 | 917..1033 | CDD:238020 | |||
| FN3 | 1040..1142 | CDD:238020 | |||
| fn3 | 1150..1237 | CDD:278470 | |||
| FN3 | 1263..1345 | CDD:238020 | |||
| Ig | 1350..1436 | CDD:299845 | |||
| IG_like | 1358..1436 | CDD:214653 | |||
| FN3 | 1441..1530 | CDD:238020 | |||
| FN3 | 1542..1620 | CDD:238020 | |||
| zig-8 | NP_499714.1 | IG_like | 55..134 | CDD:214653 | 17/78 (22%) |
| Ig | 55..129 | CDD:143165 | 16/73 (22%) | ||
| ig | 158..229 | CDD:278476 | 20/72 (28%) | ||
| IG_like | 158..227 | CDD:214653 | 19/70 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||