DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and rig-5

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:449 Identity:101/449 - (22%)
Similarity:164/449 - (36%) Gaps:86/449 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 LYPIPSSQRV----ILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQV 349
            |:.||..:::    :|...||:.|.|..|.|...|.|.             |::|.|::      
 Worm    52 LFHIPLQEKMYLFALLCGVLLVFKQACSRGAPPTIQQP-------------SMSSAVAL------ 97

  Fly   350 QIVNSGGTANFNCTTTGSAIDAIDWLHNGKP---LQANNALTTGRDNIRFLSKSS-------LLV 404
                .|...:|.|.........:.::....|   |..:..:...|:......:..       |.:
 Worm    98 ----LGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPRIGDLHNEWVLTI 158

  Fly   405 QNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELI--YTFIEQNVRPGPLISLKCSASGSPP 467
            :||...|||.|.|.: |......:..||.:  .||.::  .|.....||.|..:||.|.|.|:|.
 Worm   159 KNVQESDRGNYSCQI-NTEPITLSTGELDV--KVPPVVSRSTPAAVEVREGNNVSLTCKADGNPT 220

  Fly   468 PQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQH-S 531
            |...|....:.|:..:....|....|   .|.|:....:|.....:   |.|||||.:...:. :
 Worm   221 PTVIWRRQDRQIIRYNGATGFGASVF---HGPVLHLTKVSRKHMSE---YLCVASNGIPPDESWT 279

  Fly   532 ARLNVYGPPYVRAIG-PIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQ 595
            .:|.|..||.|:|.. .::|..|....:.|....:|..::.|||..:.:..||:..:.....|..
 Worm   280 VKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQY 344

  Fly   596 -----LVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLN-------VNSPPVIEPFKFPKNLQEG 648
                 |.|:||:... .|:|.|:.::..|.. ...:.||       .||..:.|....|:...|.
 Worm   345 HSVHILEIRNVQSSH-FGVYRCVAKNDNGIH-HSQVTLNQISHNHFTNSNLIPEGSGMPRGYSED 407

  Fly   649 GRA---QITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGK 704
            ..|   :........|.      :::||..|..|       ||||.      :.||..:
 Worm   408 DEADEEEDNLENQKNDS------EEEDSQSPPQL-------EFYSQ------ARRHESR 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 12/51 (24%)
Ig 264..334 CDD:143165 12/48 (25%)
I-set 345..433 CDD:254352 16/97 (16%)
Ig 358..431 CDD:143165 14/82 (17%)
Ig 456..533 CDD:143165 20/77 (26%)
IGc2 553..619 CDD:197706 16/70 (23%)
I-set 634..724 CDD:254352 15/74 (20%)
ig 645..712 CDD:278476 13/63 (21%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 19/109 (17%)
Ig_3 191..270 CDD:372822 22/84 (26%)
IG 294..380 CDD:214652 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.