DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Dscam

DIOPT Version :10

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus


Alignment Length:85 Identity:20/85 - (23%)
Similarity:35/85 - (41%) Gaps:22/85 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSENLWKMKFVSLN-----NWNVGTALPRILKKCDTESLKSIKLKMKYETAESMENIAALEQ--- 127
            |||:..::: |.||     :.|...:..:|||:||:..|:.  |.......:|...|...|:   
Mouse   972 DSESASRLQ-VILNEIQPRDTNDYFSQAKILKECDSFDLED--LSTSVSNIDSSAEIKGKEEKAC 1033

  Fly   128 -----------WNHVKELEI 136
                       |..:||:.:
Mouse  1034 DVTAQMVLTCCWRSMKEVAL 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 Ig 38..135 CDD:472250 20/82 (24%)
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353 1/1 (100%)
Ig strand E 93..97 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 0/4 (0%)
Ig strand G 126..130 CDD:409353 2/17 (12%)
Ig 246..337 CDD:472250
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 317..322 CDD:409353
Ig strand G 330..333 CDD:409353
Ig 341..434 CDD:472250
Ig strand B 358..362 CDD:409353
Ig strand C 371..375 CDD:409353
Ig strand E 400..404 CDD:409353
Ig strand F 414..419 CDD:409353
Ig strand G 427..430 CDD:409353
IgI_4_Dscam 439..536 CDD:409548
Ig strand A' 447..451 CDD:409548
Ig strand B 454..463 CDD:409548
Ig strand C 468..474 CDD:409548
Ig strand C' 476..479 CDD:409548
Ig strand D 487..495 CDD:409548
Ig strand E 499..508 CDD:409548
Ig strand F 515..523 CDD:409548
Ig strand G 526..536 CDD:409548
Ig 539..630 CDD:472250
Ig strand B 556..560 CDD:409353
Ig strand C 569..573 CDD:409353
Ig strand E 594..598 CDD:409353
Ig strand F 609..614 CDD:409353
Ig strand G 623..626 CDD:409353
Ig 633..724 CDD:472250
Ig strand B 651..655 CDD:409353
Ig strand C 665..669 CDD:409353
Ig strand E 690..694 CDD:409353
Ig strand F 704..709 CDD:409353
Ig strand G 717..720 CDD:409353
Ig 728..815 CDD:472250
Ig strand B 745..749 CDD:409353
Ig strand C 758..762 CDD:409353
Ig strand E 780..784 CDD:409353
Ig strand F 794..799 CDD:409353
Ig strand G 808..811 CDD:409353
Ig 820..913 CDD:472250
Ig strand C 849..853 CDD:409353
Ig strand E 879..883 CDD:409353
Ig strand F 893..898 CDD:409353
Ig strand G 906..909 CDD:409353
FN3 <940..1417 CDD:442628
Ig 1355..1430 CDD:472250
Ig strand B 1368..1372 CDD:409353
Ig strand C 1381..1385 CDD:409353
Ig strand E 1403..1407 CDD:409353
Ig strand F 1417..1422 CDD:409353
Ig strand G 1430..1433 CDD:409353
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
DscamXP_006522949.1 Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409547
Ig strand C 55..59 CDD:409547
Ig strand E 79..83 CDD:409547
Ig strand F 99..104 CDD:409547
Ig strand G 112..116 CDD:409547
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
Ig 235..310 CDD:472250
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
Ig 504..593 CDD:472250
Ig strand B 521..525 CDD:409353
Ig strand C 534..538 CDD:409353
Ig strand E 557..561 CDD:409353
Ig strand F 572..577 CDD:409353
Ig strand G 586..589 CDD:409353
Ig 596..686 CDD:472250
Ig strand B 613..617 CDD:409353
Ig strand C 627..631 CDD:409353
Ig strand E 652..656 CDD:409353
Ig strand F 666..671 CDD:409353
Ig strand G 679..682 CDD:409353
Ig_DSCAM 689..784 CDD:409397
putative Ig strand A 689..693 CDD:409397
putative Ig strand A' 698..702 CDD:409397
putative Ig strand B 704..714 CDD:409397
putative Ig strand C 720..726 CDD:409397
putative Ig strand C' 733..736 CDD:409397
putative Ig strand D 744..747 CDD:409397
putative Ig strand E 749..755 CDD:409397
putative Ig strand F 762..770 CDD:409397
putative Ig strand G 775..784 CDD:409397
Ig_DSCAM 785..884 CDD:409398
putative Ig strand A 785..788 CDD:409398
putative Ig strand A' 796..800 CDD:409398
putative Ig strand B 803..810 CDD:409398
putative Ig strand C 818..824 CDD:409398
putative Ig strand C' 833..836 CDD:409398
putative Ig strand D 842..846 CDD:409398
putative Ig strand E 848..854 CDD:409398
putative Ig strand F 861..869 CDD:409398
putative Ig strand G 872..882 CDD:409398
FN3 885..978 CDD:238020 3/5 (60%)
FN3 <937..1300 CDD:442628 20/85 (24%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.