DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and AgaP_AGAP009242

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_320020.4 Gene:AgaP_AGAP009242 / 1280197 VectorBaseID:AGAP009242 Length:275 Species:Anopheles gambiae


Alignment Length:195 Identity:44/195 - (22%)
Similarity:76/195 - (38%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 MLGNTISINCEAEGYPIPTITWFK---------GQGKGSKDFKPLSMRN-----HSLLLNLATDN 790
            ::|||..:||........|::|.:         |:...:.|.:..|:.|     .||.:......
Mosquito    69 LVGNTAYLNCRVRNLGNRTVSWIRHRDLHLLTVGKATYTSDQRYQSVHNPQLDDWSLKVLYPQQR 133

  Fly   791 DEGYYMCQATNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAK------------ 843
            |.|.|.||.:.....|.  ::.::|.||........::.......|.|.|..:            
Mosquito   134 DSGVYECQISTTPPVGY--S
MMLSVVEPITTIIGGPDLYIDTGSTVNLTCIVRHGTTATDTALIC 196

  Fly   844 ---GDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKG--VDSQLTIGHSDRHDSGVYRCI--AENP 901
               |...:|:.:|::...|:.::.|..::.: ||||  ..|.|.|..:...|||.|.|:  ..||
Mosquito   197 LQTGPFALTLSFTRSLQEINYDSPRGGVSVI-TEKGDITTSYLLIQRARSTDSGKYTCLPSTANP 260

  Fly   902  901
            Mosquito   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653 19/88 (22%)
Ig 745..815 CDD:299845 16/83 (19%)
I-set 820..913 CDD:254352 22/101 (22%)
Ig 838..920 CDD:299845 21/83 (25%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
AgaP_AGAP009242XP_320020.4 IG_like 63..151 CDD:214653 19/83 (23%)
Ig 66..150 CDD:299845 18/80 (23%)
IG_like 167..267 CDD:214653 22/95 (23%)
Ig 174..253 CDD:299845 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.