DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and AgaP_AGAP009183

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_319953.4 Gene:AgaP_AGAP009183 / 1280143 VectorBaseID:AGAP009183 Length:317 Species:Anopheles gambiae


Alignment Length:232 Identity:54/232 - (23%)
Similarity:93/232 - (40%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 GQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGP--IKAVAG 553
            |.|..|..:..:|..|               ::.:||:   |.|    |..||.||.  :..:..
Mosquito    84 GNFSKMYFETDNHTTI---------------ASQVGSI---AVL----PCAVRNIGEGVVSWIRR 126

  Fly   554 EDI-IVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSR 617
            :|. ::...|..|..:: |:...|.|.|           :...|.||.|:. ||.|:|.|.|.:.
Mosquito   127 KDYHLLTIGFTTYSSDE-RFNIIHSEDT-----------EEWPLQIKYVQL-RDAGLYECQVSTH 178

  Fly   618 AGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITC-AVSSGDMPIYFSWKKDDSSI----PS 677
            ........:.:......:..|.:  |.|:.|...::|| .|.|.:.|:|..|..::..|    ..
Mosquito   179 PPTSIFVKLDVVEAKAEIFGPSE--KYLKPGSMLRLTCRVVQSNEPPLYIFWYHNNRMINYDAHR 241

  Fly   678 SLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAA 714
            .:.::.:.:..||.||....:..:||.|:|.::||.|
Mosquito   242 GVNVSTEADNRYSELVISHTNTLNSGNYSCVSNNAVA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165 7/41 (17%)
IGc2 553..619 CDD:197706 17/66 (26%)
I-set 634..724 CDD:254352 23/86 (27%)
ig 645..712 CDD:278476 18/71 (25%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
AgaP_AGAP009183XP_319953.4 IG_like 102..189 CDD:214653 26/106 (25%)
Ig 104..189 CDD:299845 26/104 (25%)
IG_like 199..276 CDD:214653 20/78 (26%)
Ig 210..275 CDD:143165 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.