DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and AgaP_AGAP008778

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_314904.3 Gene:AgaP_AGAP008778 / 1275637 VectorBaseID:AGAP008778 Length:241 Species:Anopheles gambiae


Alignment Length:303 Identity:69/303 - (22%)
Similarity:109/303 - (35%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 PIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVH--ILPQVQIVN 353
            |||:. .|.:.|..||            .|...|..|.:...:|:...:.:|:|  ::.|    |
Mosquito     6 PIPNI-TVTIGRDALL------------ACVVDNLKGYKVAWVRVDTQTILSIHHNVITQ----N 53

  Fly   354 SGGTANFNCTTTGSAIDAIDW-LHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQC 417
            ...:..:|        |...| ||                           ::.|...|||.|.|
Mosquito    54 PRISLTYN--------DHRSWYLH---------------------------IREVEESDRGWYMC 83

  Fly   418 LVENQRASAQAMAELK--LGDTVPELIYTFIEQN---VRPGPLISLKCSASGSPPPQFAWLLDSQ 477
            .|     :...|...|  |...||..|...:..|   ||.|..::|.|.|.|.|.|...|..:..
Mosquito    84 QV-----NTDPMRSRKGYLQVVVPPAIIESMTSNDMVVREGTNVTLNCKAKGFPEPYVMWRREDG 143

  Fly   478 PIMDVSLHHRFAIGQFVD-MSGDVISHLNISHVRPDDGGLYKCVASNSM-GSVQHSARLNVYGPP 540
            ..|.:|       |:.|: :.|:::....:|.:..   ..|.|||||.: .|:....:|.|..||
Mosquito   144 DEMAIS-------GENVNVVDGEILHITKVSRLHM---AAYLCVASNGVPPSISKRVQLRVQFPP 198

  Fly   541 YVRAIGPIK-AVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTS 582
            .:.....:: |..|:|:::.|....||.....|.....::..|
Mosquito   199 MLSIPNQLEGAYVGQDVVLECHTEAYPASINYWTTERGDMIIS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 11/45 (24%)
Ig 264..334 CDD:143165 10/42 (24%)
I-set 345..433 CDD:254352 15/88 (17%)
Ig 358..431 CDD:143165 13/73 (18%)
Ig 456..533 CDD:143165 20/78 (26%)
IGc2 553..619 CDD:197706 7/30 (23%)
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
AgaP_AGAP008778XP_314904.3 IG_like 8..101 CDD:214653 28/149 (19%)
Ig 9..99 CDD:299845 27/146 (18%)
IG_like 111..194 CDD:214653 25/92 (27%)
IGc2 118..182 CDD:197706 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.