DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and AgaP_AGAP002708

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_312220.4 Gene:AgaP_AGAP002708 / 1273260 VectorBaseID:AGAP002708 Length:382 Species:Anopheles gambiae


Alignment Length:243 Identity:53/243 - (21%)
Similarity:91/243 - (37%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 ISARHSGKYTCYASNAAAKV---NYTA-ELQVRVAPRWRYEPMDTAIMLGNTISINCE-AEGY-- 754
            |.:..:|.|.|..|....:|   |.|. |..||:.....||..|....||:||.|:|: :..|  
Mosquito   131 IKSDDAGLYMCQVSTHPPRVFATNLTVL
EPAVRIVDEMGYEFSDRYYKLGSTIEISCQVSTSYLA 195

  Fly   755 PIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEPA 819
            .:|......||.:.||                             |:.:||....     ::|.|
Mosquito   196 TLPPSPKSAGQQQRSK-----------------------------TSPVGASANA-----LDETA 226

  Fly   820 RFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIG 884
            :....|....::.:|         ..|...|.||::...:. .:.:.|.:  .|::.:.|:::|.
Mosquito   227 KTGSKATKDDNKLSD---------STERGLISWTKDGAELP-KDVKMSFS--GTKQWLISRISIL 279

  Fly   885 HSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDTPS--------HLE 924
            .::|..:|||.|.......:|.|:..|    ..:||:        |:|
Mosquito   280 QANRVHNGVYNCTVAGKQSQAAQVQVL----NGETPAAVQHNFGHHIE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 9/30 (30%)
ig 645..712 CDD:278476 5/14 (36%)
IG_like 734..815 CDD:214653 16/83 (19%)
Ig 745..815 CDD:299845 12/72 (17%)
I-set 820..913 CDD:254352 18/92 (20%)
Ig 838..920 CDD:299845 16/81 (20%)
FN3 917..1033 CDD:238020 4/16 (25%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
AgaP_AGAP002708XP_312220.4 IG_like 74..157 CDD:214653 7/25 (28%)
Ig <90..158 CDD:299845 8/26 (31%)
I-set <248..305 CDD:254352 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.