Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036015651.1 | Gene: | Cd80 / 12519 | MGIID: | 101775 | Length: | 314 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 54/238 - (22%) |
---|---|---|---|
Similarity: | 84/238 - (35%) | Gaps: | 69/238 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 266 LPCNIQGNPFPIFTWYRVSDSAAL-YPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQ 329
Fly 330 RIEIRLSVNSYVSVHILPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGK-------------PL 381
Fly 382 QANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFI 446
Fly 447 EQNVRP--GPLISLK---CSASGS-PPPQFAWLLDSQPIMDVS 483 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
Ig | 56..125 | CDD:143165 | |||
I-set | 246..337 | CDD:254352 | 16/71 (23%) | ||
Ig | 264..334 | CDD:143165 | 16/68 (24%) | ||
I-set | 345..433 | CDD:254352 | 20/100 (20%) | ||
Ig | 358..431 | CDD:143165 | 18/85 (21%) | ||
Ig | 456..533 | CDD:143165 | 10/32 (31%) | ||
IGc2 | 553..619 | CDD:197706 | |||
I-set | 634..724 | CDD:254352 | |||
ig | 645..712 | CDD:278476 | |||
IG_like | 734..815 | CDD:214653 | |||
Ig | 745..815 | CDD:299845 | |||
I-set | 820..913 | CDD:254352 | |||
Ig | 838..920 | CDD:299845 | |||
FN3 | 917..1033 | CDD:238020 | |||
FN3 | 1040..1142 | CDD:238020 | |||
fn3 | 1150..1237 | CDD:278470 | |||
FN3 | 1263..1345 | CDD:238020 | |||
Ig | 1350..1436 | CDD:299845 | |||
IG_like | 1358..1436 | CDD:214653 | |||
FN3 | 1441..1530 | CDD:238020 | |||
FN3 | 1542..1620 | CDD:238020 | |||
Cd80 | XP_036015651.1 | IgV_CD80 | 47..150 | CDD:319335 | 27/127 (21%) |
Ig strand B | 58..62 | CDD:319335 | 3/16 (19%) | ||
Ig strand C | 75..79 | CDD:319335 | 1/3 (33%) | ||
Ig strand E | 110..114 | CDD:319335 | 2/7 (29%) | ||
Ig strand F | 124..129 | CDD:319335 | 2/4 (50%) | ||
Ig strand G | 142..145 | CDD:319335 | 2/4 (50%) | ||
IgC1_CD80 | 153..243 | CDD:409505 | 13/45 (29%) | ||
Ig strand B | 169..173 | CDD:409505 | 1/3 (33%) | ||
Ig strand C | 183..187 | CDD:409505 | 1/3 (33%) | ||
Ig strand E | 213..217 | CDD:409505 | |||
Ig strand F | 224..229 | CDD:409505 | |||
Ig strand G | 237..240 | CDD:409505 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |