DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Psg29

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_473405.1 Gene:Psg29 / 114872 MGIID:1891361 Length:468 Species:Mus musculus


Alignment Length:393 Identity:91/393 - (23%)
Similarity:143/393 - (36%) Gaps:124/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LHFPPFLAQYYRTDVHEATYRCRASNEAGTVLSRNVQVH---AVVRRQFHV--HVENTEVYLGNS 154
            ||..|||            :.|     ...|.|...::.   ::|....||  ||.|        
Mouse   134 LHVNPFL------------WNC-----GRLVTSSQPRIESFPSIVTEGQHVILHVYN-------- 173

  Fly   155 ALIKCAIPEYVRPYVRVASW------HRGEEILLPDLSDVAGRYVV----------------LAA 197
                  |||.::.::    |      ||..||         |||.:                |.:
Mouse   174 ------IPENLQGFI----WFKGMTVHRHLEI---------GRYTIGRKSSVFGPAYSGREKLDS 219

  Fly   198 SGDLYVRSVRSED-GLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLA-PRTTQKPVMEI---H 257
            :|.|.:.:|..:| ||.....|.|:..:.|..    |.|||...:.... |.|:.|.::|.   :
Mouse   220 NGSLRIENVTQKDAGLYTLRVLGTDMKSEEAH----VELQVNNPAFQCCNPSTSSKLMVEAVPRY 280

  Fly   258 VERGNDVHLPCNIQGNPFPIFTWYRVSDSAALYPIPSSQRV--------------------ILSR 302
            |..|..|.|..:........||||.     ::|.:|:.:.|                    :.:.
Mouse   281 VAEGESVLLLVHNLPEELISFTWYN-----SMYRVPAFKIVEFNVIRNITTWGDVYRGRDTVYAN 340

  Fly   303 TLLLIKNADERDAGKWICQASN-QFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTAN------F 360
            ..|::::..|.||..:..:..| .:..:|..::..||..|:   .|.|||.::  |||      |
Mouse   341 GSLMLQDVTEEDARMYTLETLNVNYTVERAHVQFYVNKPVT---QPFVQITDT--TANAQRSLTF 400

  Fly   361 NCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRAS 425
            .|.|...| .:|.|..|...|:....:|...      :|..|.:.:|...|.|.|||:|.|:...
Mouse   401 TCVTPDIA-TSILWFFNSHSLKPTERITLSP------TKCGLRIDDVRSEDAGNYQCVVVNRNGD 458

  Fly   426 AQA 428
            |:|
Mouse   459 AKA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652 8/37 (22%)
Ig 56..125 CDD:143165 6/29 (21%)
I-set 246..337 CDD:254352 21/114 (18%)
Ig 264..334 CDD:143165 15/90 (17%)
I-set 345..433 CDD:254352 28/90 (31%)
Ig 358..431 CDD:143165 23/77 (30%)
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Psg29NP_473405.1 Ig_CEACAM_D1 36..136 CDD:143251 1/1 (100%)
Ig_CEACAM_D1 152..256 CDD:143251 29/134 (22%)
IG_like <209..256 CDD:214653 12/50 (24%)
Ig_CEACAM_D1 272..376 CDD:143251 18/108 (17%)
I-set 384..462 CDD:254352 27/87 (31%)
IGc2 396..457 CDD:197706 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.