DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and LOC102557319

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:NP_001316821.1 Gene:LOC102557319 / 102557319 RGDID:7698003 Length:475 Species:Rattus norvegicus


Alignment Length:467 Identity:98/467 - (20%)
Similarity:171/467 - (36%) Gaps:99/467 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GTVLSRNVQVHAVVRRQFHVHVENT--EVYLGNSALIKC-AIPEYVRPYVRVASWHRGEEILLPD 184
            |.:|:.::....::.....|.:|::  :|..|.:.|:.. .:||.:..:    .|.:||..:...
  Rat    17 GFLLTASLLTSWLLPTTAQVTLESSPPQVVEGENVLLSVDNMPENIIGF----GWFKGETDMNRG 77

  Fly   185 LSDVAGRYVV------------LAASGDLYVRSVRSED-GLMKFSCLVTNTLNGERQRSDAVMLQ 236
            ::..:.||.:            |..:|.|::::|..|| |...|..:   ..:|:.|.:..:.|.
  Rat    78 IALYSLRYTISLMGPVHSGRETLYGNGSLWIKNVTQEDTGFYTFRII---NKHGKIQSNTTLFLH 139

  Fly   237 VK-ELSKNLAPRTTQKPVME---IHVERGNDV-----HLPCNIQGNPFPIFTWYR---------- 282
            || .|.....|...::|.:|   :.|.....|     |||     |......|||          
  Rat   140 VKSSLFVCGHPFNPEQPTIESVPVSVSEWGSVLLRVHHLP-----NYLRTLFWYRGALVLNKLEI 199

  Fly   283 -----VSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQA-SNQFGEQRIEIRLSVNSYV 341
                 ..||..|.|..|.:..:.:...||::|...:|.|.:..:. |.:|..:.|.|.|.||:.:
  Rat   200 VRYRTFKDSYELGPAHSGRETMFNTGSLLLQNVTWKDTGFYTLRTLSTEFNVELIHIYLQVNTSL 264

  Fly   342 S----------VHILPQVQIVNSGGTANFNCTTTGSAIDAIDW------LHNGK----------- 379
            |          :.|.|..:.|..|.:..........|:....|      |...|           
  Rat   265 SSCCDPITPAPLTIDPVPRHVAEGESVLLYVHNLPEALQTFSWYKGVYSLKEFKIAEYSIATKSV 329

  Fly   380 -PLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQ-AMAELKLGDTVPELI 442
             |..|:....||..|      .|||:|::..:|.|:|..:..:..|:.: |..::.:...|.:.|
  Rat   330 FPGPAHRGRATGYTN------GSLLLQDLTEKDSGLYTLVTLDSNANIETAHVQVTVHKPVTQPI 388

  Fly   443 YTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNIS 507
            ....|..|.....:...| .|.:......||..:|   ::.:..|..:       ......|.|.
  Rat   389 LRVTESIVTVQSSVVFTC-LSDNTGVSIRWLFKNQ---NLQVTERMTL-------SPSNCQLRIH 442

  Fly   508 HVRPDDGGLYKC 519
            .||..|.|.|:|
  Rat   443 AVRKKDAGQYRC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652 2/9 (22%)
Ig 56..125 CDD:143165 1/1 (100%)
I-set 246..337 CDD:254352 27/114 (24%)
Ig 264..334 CDD:143165 21/90 (23%)
I-set 345..433 CDD:254352 22/106 (21%)
Ig 358..431 CDD:143165 18/91 (20%)
Ig 456..533 CDD:143165 14/64 (22%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
LOC102557319NP_001316821.1 Ig_CEACAM_D1 36..140 CDD:143251 23/110 (21%)
IG_like 45..136 CDD:214653 20/97 (21%)
Ig_CEACAM_D1 156..260 CDD:143251 26/108 (24%)
Ig_CEACAM_D1 276..380 CDD:143251 22/109 (20%)
Ig 382..472 CDD:299845 18/84 (21%)
IG_like 396..472 CDD:214653 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.