| Sequence 1: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002938252.1 | Gene: | iglon5 / 100488314 | XenbaseID: | XB-GENE-945713 | Length: | 333 | Species: | Xenopus tropicalis |
| Alignment Length: | 265 | Identity: | 66/265 - (24%) |
|---|---|---|---|
| Similarity: | 112/265 - (42%) | Gaps: | 52/265 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 472 WLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNV 536
Fly 537 YGPPYVRAIGPIKAV---------AGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVAD 592
Fly 593 GGQLVIKNVEPGRDQ-GIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQE--GGRAQIT 654
Fly 655 CAVSSGDMPIYFSWKKDDSS--IPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVN 717
Fly 718 YTAEL 722 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
| Ig | 56..125 | CDD:143165 | |||
| I-set | 246..337 | CDD:254352 | |||
| Ig | 264..334 | CDD:143165 | |||
| I-set | 345..433 | CDD:254352 | |||
| Ig | 358..431 | CDD:143165 | |||
| Ig | 456..533 | CDD:143165 | 14/60 (23%) | ||
| IGc2 | 553..619 | CDD:197706 | 14/66 (21%) | ||
| I-set | 634..724 | CDD:254352 | 30/93 (32%) | ||
| ig | 645..712 | CDD:278476 | 23/70 (33%) | ||
| IG_like | 734..815 | CDD:214653 | |||
| Ig | 745..815 | CDD:299845 | |||
| I-set | 820..913 | CDD:254352 | |||
| Ig | 838..920 | CDD:299845 | |||
| FN3 | 917..1033 | CDD:238020 | |||
| FN3 | 1040..1142 | CDD:238020 | |||
| fn3 | 1150..1237 | CDD:278470 | |||
| FN3 | 1263..1345 | CDD:238020 | |||
| Ig | 1350..1436 | CDD:299845 | |||
| IG_like | 1358..1436 | CDD:214653 | |||
| FN3 | 1441..1530 | CDD:238020 | |||
| FN3 | 1542..1620 | CDD:238020 | |||
| iglon5 | XP_002938252.1 | Ig | 31..123 | CDD:299845 | 15/71 (21%) |
| IG_like | 35..123 | CDD:214653 | 15/71 (21%) | ||
| Ig | 126..207 | CDD:299845 | 18/92 (20%) | ||
| I-set | 128..207 | CDD:254352 | 17/90 (19%) | ||
| I-set | 210..299 | CDD:254352 | 30/92 (33%) | ||
| Ig | 227..298 | CDD:143165 | 23/71 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||