DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and igsf9b

DIOPT Version :10

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_031761656.1 Gene:igsf9b / 100379858 XenbaseID:XB-GENE-5887265 Length:1392 Species:Xenopus tropicalis


Alignment Length:1531 Identity:316/1531 - (20%)
Similarity:499/1531 - (32%) Gaps:473/1531 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 PQVQIVNSGGTANFNC-----TTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRF---------- 396
            ||.....:|.:....|     .|.......::|...|.|:..         .|:|          
 Frog    30 PQFVTARAGESVILGCDVVHPLTVQPPPYVVEWFKFGVPIPI---------FIKFGFYPPHVDPE 85

  Fly   397 -------LSKSSLLVQNVGRRDRGVYQC---LVENQRASAQAMAELKLGDTVPELIYTFIEQ--- 448
                   ..|:||.::.|..:|:|.|:|   ::|:|..:....:.:.|....|.   ||.|.   
 Frog    86 YVGRAALYDKASLRIEQVRSQDQGWYECKVLMLEHQYDTFHNGSWVHLTVNAPP---TFTETPPQ 147

  Fly   449 --NVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRP 511
              .|:.|..|:|.|:|.|:|.|..:||.:.:.:...|.:      |..|.|      |.||.:..
 Frog   148 YLEVKEGSSITLTCTAFGNPKPTVSWLREGEFLGRTSKY------QLSDGS------LTISSIGR 200

  Fly   512 DDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGP---IKAVAGEDIIVHCPFAGYPVE-QIRW 572
            :|.|.|.|.|::..|...||.||.|.|.|::  :.|   |.....:|.:..|....||.. ...|
 Frog   201 EDRGSYMCRATSIQGEAVHSTRLLVQGSPFI--VSPPENITVNISQDALFTCQAEAYPGNLTYTW 263

  Fly   573 EKAHQELTTSNHYEL-ASVADGGQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLN------- 629
            ....:.:...|..:| ..:...|.|:|..|:| .|.|.|||:..:..|........|.       
 Frog   264 YWQEENVFFKNDLKLRVRILIDGTLIIFRVKP-EDAGKYTCVPSNSLGRSPSASAYLTVQYPARV 327

  Fly   630 VNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSI------------PSSLQIT 682
            ||.||||       .:..|....|.|.|.:.....:..|.||...:            ..::.:.
 Frog   328 VNMPPVI-------YVPVGIHGHIRCPVEAVPPVTFVKWNKDGRPLRIDKFSGWKLLDDGTIHVE 385

  Fly   683 EKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYT--AELQVR------VAPRWRYEPMDTAI 739
            |..||..             |.|||...||...:..:  |.|.::      |.|.|.|..     
 Frog   386 EATEELL-------------GTYTCVPYNALGTMGQSPPARLLLKDPPYFTVLPGWEYRQ----- 432

  Fly   740 MLGNTISINCEAEGYPIPTITWFK-GQ---------GKGSKDFKPLSMRNHSLLLNLATDNDEGY 794
            ..|..:.|.|.|.|.|.|:|:|.| |:         ..||..|:.||..:|            |.
 Frog   433 EAGRELLIPCAAAGDPFPSISWRKVGRPSFSKHSVLPSGSLQFRSLSKEDH------------GE 485

  Fly   795 YMCQATN---EIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNN 856
            :.|.|:|   .|.|....|:   :........:.|.:.|.....|:.:....|      |:.|. 
 Frog   486 WECVASNVVTSITASAHLTV---IGTSPHAPSNVRVVVSMNTANVSWEAGYDG------GFEQT- 540

  Fly   857 GRIDLNNFRFSI----------------AEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRA 905
                     ||:                ..|....| .|.|.:...|......:..:|:|..|.:
 Frog   541 ---------FSVWYGALIKRAQFGPHDWVSMPVPSG-SSFLLVDSLDPETEYQFSVLAQNKLGTS 595

  Fly   906 --EQIIFLAVQERP-DTPSHLEIFE-----VGSRT---VKLSWRRPFDGNSPVLSYLVQYQALK- 958
              .:::.|.....| .||..|.:..     ..:||   |.|||..|.:.:.|:..|:::::..: 
 Frog   596 SFSEVVTLRTLAFPLTTPEPLLVLTSPRCLTANRTQQGVLLSWLPPSNHSFPLDRYIMEFRLAER 660

  Fly   959 -------YLQSHGSLAA---AGGDW-NGHVINV-----SLPS----TSISRSYDS-DLRESA--- 999
                   .|.|...:.|   :...| ...|:.|     |.||    .|.|..:.| ||.|..   
 Frog   661 WEILDDSILGSDTEILAKELSQDTWYEFRVLAVMQDLISEPSNIAGVSSSDVFPSPDLSEEGFAR 725

  Fly  1000 -IVAGLTPATTFL-------------IRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNV-QVQT 1049
             ::||:.....||             :..|...:::|.        |.....||:.|.:: ..:.
 Frog   726 PVLAGIVATICFLAAAILFSTLAACVVNRQRKRKMKRK--------KVSHSCPTDPPLSITHCRK 782

  Fly  1050 GGESELIVTWQIPPRESWNGELIGYTVNCSEEKQNINFISVVNSSLKSTIVSGWATTKATLRGLR 1114
            ..||.|                       |..|.:...:..:.:..:|:...|..:.:....|..
 Frog   783 SMESPL-----------------------SSGKVSPESVRTLRAPSESSEDQGPPSKRPLSPGRE 824

  Fly  1115 K-YSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQNVNCTALSSQSLKISWLEPPLQFHGG 1178
            | .|.|..|.|||.|.......|....||...:....|.....||...|       ||.|:... 
 Frog   825 KELSLYKKTKRAMTSKKYSVSQAEAEVTTPIELISRGPDGRFVTAGPEQ-------EPTLRSRR- 881

  Fly  1179 IIQGYKILYRPIVHQID-FP----AKLEIKRTSNLETYLHTLHKASNYSIRVLAYT--------- 1229
             |||:     |...:.| :|    :..|....|.|::.|..|..:.:..::..||:         
 Frog   882 -IQGF-----PFAEETDMYPEFRQSDEENDEPSGLKSQLTPLSSSQDSPLQPPAYSPRFQHQPSE 940

  Fly  1230 ----ATGDG-------------LASHPLFCQTDDDVPDAPAAIKAAALTADSILIS-WLTPK--- 1273
                .:|..             |:|.||    |.|.|  |...........|::.| .|.|:   
 Frog   941 GRQQPSGQSRPGGYHHGHLYGYLSSSPL----DSDPP--PPFYMPEVSPLSSVMSSPPLLPEGSF 999

  Fly  1274 ----NRNG--------IISHYTVYSREAGRKGQAKTHMVRVDENGYPVTFESRSLAENQMYEFWV 1326
                ..||        .::|.....|...:.|......|.::....|      ||.....||   
 Frog  1000 PPIPEENGENSSTSTLPLTHTPTGGRSPEQWGVPDFPFVGLEAPASP------SLFVQHRYE--- 1055

  Fly  1327 SASTSV--------------GEGEPTSVIAQATNT------------RAPAR------------- 1352
              :|.:              |...|:|:...:...            |.|:|             
 Frog  1056 --TTEIRRPLPPPPPLPFPHGHPPPSSLQVPSYAAILPLESHPGWVGRLPSRCPPPPHPSWQDAA 1118

  Fly  1353 --IASFGQVVRKAVGTGL-VLECLAVGNPTP---RARWL-TRDRPVTFSPFYEVTNEGNLKIHRV 1410
              :|:.||:...:.|.|: ||....:..|.|   .|||. :|.|| ..||......:.:|  |:|
 Frog  1119 MQLAAQGQLRHTSQGMGIPVLPYPDIPQPGPLGMDARWFESRPRP-QMSPRQHRRLDPSL--HQV 1180

  Fly  1411 ---EGSLSGNYTCTANNLFGSDEIQYQV---------------IAMKPPSAPQIIVQYASADSIR 1457
               ...||.......::..||.|:..:.               ||::||.               
 Frog  1181 VLQPSRLSPLTQSPLSSRHGSPELSVRARPRPGLLPPPSDCSGIALQPPG--------------- 1230

  Fly  1458 VSWDAPDDGGAPLQGYTISYHTAGESWSITELLPENNAFTISGLKCGNQYIIKMSAHNMV----G 1518
            ....:|...|:|.:    |.|....|:.:|.  |:.:.......:.|.:   ::.|...|    |
 Frog  1231 FIHKSPPSSGSPAK----SSHGESPSYRLTP--PDTSPHAEGRRRIGEE---RLHAETAVLCTAG 1286

  Fly  1519 SGVAS----EEINV---------WTKGKA----------SQAPNANELIATNATCVNLK------ 1554
            .|:|:    .|:.:         .|||::          ||.....:.:..:..||..|      
 Frog  1287 VGIAAVPERSEVVIDQRVLKPKKSTKGRSKSRKHSDGSTSQVYQLPQAVYMDTRCVRRKKRPTRQ 1351

  Fly  1555 -----LSSWQNGGCSIHHFSIEHRPLGDIRWTVVTS 1585
                 ||:.::..|        ||.|.|.|..::||
 Frog  1352 DPLSRLSALRDELC--------HRSLSDDRAAILTS 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 Ig 38..135 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..130 CDD:409353
Ig 246..337 CDD:472250
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 317..322 CDD:409353
Ig strand G 330..333 CDD:409353
Ig 341..434 CDD:472250 20/111 (18%)
Ig strand B 358..362 CDD:409353 0/3 (0%)
Ig strand C 371..375 CDD:409353 0/3 (0%)
Ig strand E 400..404 CDD:409353 2/3 (67%)
Ig strand F 414..419 CDD:409353 2/7 (29%)
Ig strand G 427..430 CDD:409353 0/2 (0%)
IgI_4_Dscam 439..536 CDD:409548 32/101 (32%)
Ig strand A' 447..451 CDD:409548 1/8 (13%)
Ig strand B 454..463 CDD:409548 3/8 (38%)
Ig strand C 468..474 CDD:409548 2/5 (40%)
Ig strand C' 476..479 CDD:409548 0/2 (0%)
Ig strand D 487..495 CDD:409548 1/7 (14%)
Ig strand E 499..508 CDD:409548 2/8 (25%)
Ig strand F 515..523 CDD:409548 4/7 (57%)
Ig strand G 526..536 CDD:409548 5/9 (56%)
Ig 539..630 CDD:472250 22/102 (22%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 0/3 (0%)
Ig strand E 594..598 CDD:409353 2/3 (67%)
Ig strand F 609..614 CDD:409353 3/4 (75%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 22/104 (21%)
Ig strand B 651..655 CDD:409353 1/3 (33%)
Ig strand C 665..669 CDD:409353 0/3 (0%)
Ig strand E 690..694 CDD:409353 0/3 (0%)
Ig strand F 704..709 CDD:409353 3/4 (75%)
Ig strand G 717..720 CDD:409353 0/4 (0%)
Ig 728..815 CDD:472250 27/99 (27%)
Ig strand B 745..749 CDD:409353 1/3 (33%)
Ig strand C 758..762 CDD:409353 1/3 (33%)
Ig strand E 780..784 CDD:409353 1/3 (33%)
Ig strand F 794..799 CDD:409353 1/4 (25%)
Ig strand G 808..811 CDD:409353 0/2 (0%)
Ig 820..913 CDD:472250 17/110 (15%)
Ig strand C 849..853 CDD:409353 1/3 (33%)
Ig strand E 879..883 CDD:409353 2/3 (67%)
Ig strand F 893..898 CDD:409353 0/4 (0%)
Ig strand G 906..909 CDD:409353 0/2 (0%)
FN3 <940..1417 CDD:442628 120/613 (20%)
Ig 1355..1430 CDD:472250 23/82 (28%)
Ig strand B 1368..1372 CDD:409353 2/4 (50%)
Ig strand C 1381..1385 CDD:409353 2/3 (67%)
Ig strand E 1403..1407 CDD:409353 1/3 (33%)
Ig strand F 1417..1422 CDD:409353 0/4 (0%)
Ig strand G 1430..1433 CDD:409353 1/2 (50%)
FN3 1441..1530 CDD:238020 16/105 (15%)
FN3 1542..1620 CDD:238020 13/55 (24%)
igsf9bXP_031761656.1 IG_like 30..115 CDD:214653 18/93 (19%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 96..100 CDD:409353 2/3 (67%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 31/100 (31%)
Ig strand B 157..161 CDD:409353 2/3 (67%)
Ig strand C 170..174 CDD:409353 0/3 (0%)
Ig strand E 191..195 CDD:409353 2/9 (22%)
Ig strand F 205..210 CDD:409353 2/4 (50%)
Ig strand G 218..221 CDD:409353 1/2 (50%)
I-set 229..321 CDD:400151 22/94 (23%)
Ig strand B 246..250 CDD:409353 0/3 (0%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 3/4 (75%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Ig 344..405 CDD:409353 15/73 (21%)
Ig strand C 355..360 CDD:409353 0/4 (0%)
Ig strand E 380..384 CDD:409353 0/3 (0%)
Ig strand F 394..399 CDD:409353 3/4 (75%)
Ig 429..505 CDD:472250 24/92 (26%)
Ig strand B 438..442 CDD:409353 1/3 (33%)
Ig strand C 451..455 CDD:409353 1/3 (33%)
Ig strand E 471..475 CDD:409353 2/3 (67%)
Ig strand F 485..490 CDD:409353 1/4 (25%)
FN3 <489..>735 CDD:442628 52/265 (20%)
Ig strand G 498..501 CDD:409353 1/2 (50%)
FN3 510..605 CDD:238020 17/111 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.