DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and Cd300ld

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_002727887.2 Gene:Cd300ld / 100361633 RGDID:2319739 Length:327 Species:Rattus norvegicus


Alignment Length:238 Identity:52/238 - (21%)
Similarity:78/238 - (32%) Gaps:79/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 GPIKAVAGE--DIIVHCPFAG-------YPVEQIRWEK--------AHQELTTSNHYELASVADG 593
            ||.:..:.|  .:||.|.:|.       |......|..        |.:.|...|.   .|:.|.
  Rat    24 GPEEVSSQEQGSLIVQCQYASHWKDYRKYWCRGAEWSSCKILVETDASECLVKENR---VSIRDD 85

  Fly   594 GQLVIKNV--EPGR--DQGIYTC-IVRSRAGEEARRDMQLNVNSPPVIEP--------FKFPKNL 645
            .:..|..|  |..|  |.|||.| ||:|  |.:....:::.      |||        ...||.:
  Rat    86 QRNFIFTVTMEDLRMSDAGIYWCGIVKS--GYDPMFKVRVG------IEPGCSTAQDLLTGPKEV 142

  Fly   646 --QEGGRAQITCAVSSGDMPIYFSWKKD--------------------DSS----IPSSLQITEK 684
              ||.|...:.|.        |.||.||                    |:|    ..:.:.:.:.
  Rat   143 SSQEQGSLTVRCQ--------YGSWWKDYRKYWCRGAEWSSCKILVETDASECLVKKNRVSMRDN 199

  Fly   685 KEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVA 727
            :..|...:..:|:....:|.|.|    ...|..|....:|.|:
  Rat   200 QTNFIFTVTMEDLRMSDAGIYWC----GITKAGYDPMFKVHVS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 24/87 (28%)
I-set 634..724 CDD:254352 23/123 (19%)
ig 645..712 CDD:278476 16/92 (17%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Cd300ldXP_002727887.2 IG_like 25..>108 CDD:214653 21/85 (25%)
Ig_pIgR 27..123 CDD:143193 25/100 (25%)
IG_like 139..239 CDD:214653 22/112 (20%)
Ig_pIgR 141..237 CDD:143193 19/107 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.