DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam3 and lrit3b

DIOPT Version :9

Sequence 1:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:195 Identity:43/195 - (22%)
Similarity:74/195 - (37%) Gaps:46/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 MLGNTISINCEAEGYPIPTITWFKG------------QGKGSKDFK--------------PLSMR 778
            :||:|:.:.|||.|:|.|.:.|.|.            |.:.|.|.:              .:.:|
Zfish   291 LLGSTVLLRCEATGHPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKLFGYVQESPRVGVR 355

  Fly   779 NHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINV----NEPARF-----EQSARNISSRRND 834
            ...:.||..:.:|.|.|.|:|.|..|.. :..:.:||    .|...|     :|:.....|:|..
Zfish   356 WSVVSLNGISYSDAGEYRCRAQNMAGIS-EAVVSLNV
VGVMAEYTDFKNSDQQQTTTKSDSKRTK 419

  Fly   835 P-----VTLDCHAKGD-EPI-TIGWTQNNGRIDLNNFRFSIAEMKTE---KGVDSQLTIGHSDRH 889
            |     ..:..:..|. .|: .:..|...||..:...|.::.::...   ...|..|...|:|:|
Zfish   420 PKQKSKAMMPRNMTGSLSPLKRVLKTPKAGRDKMKRDRTAVQKLSHRHFLTASDDSLLHSHADKH 484

  Fly   890  889
            Zfish   485  484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653 24/100 (24%)
Ig 745..815 CDD:299845 21/95 (22%)
I-set 820..913 CDD:254352 16/85 (19%)
Ig 838..920 CDD:299845 11/57 (19%)
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566
LRR_4 160..201 CDD:289563
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378
leucine-rich repeat 215..230 CDD:275378
Ig 278..391 CDD:299845 24/100 (24%)
I-set 279..391 CDD:254352 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.