DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and RBOHD

DIOPT Version :10

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_199602.1 Gene:RBOHD / 834842 AraportID:AT5G47910 Length:921 Species:Arabidopsis thaliana


Alignment Length:208 Identity:42/208 - (20%)
Similarity:67/208 - (32%) Gaps:96/208 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FRGTLNP--------YNNGPGTCITYDAINAAYLDARKRIHVAQPKS------------------ 91
            ||.::.|        |   ||..::              :|:.:|:.                  
plant   609 FRSSIKPVKMIKVAVY---PGNVLS--------------LHMTKPQGFKYKSGQFMLVNCRAVSP 656

  Fly    92 -DWKPEELATV-GELLLDISIQLARTYGLSYEEIEKGLPTIDTSKTLIREVCPPFFAGVECRPGK 154
             :|.|..:.:. |:..|.:.|   ||.|....::          :|:..|||.|..||   :.|.
plant   657 FEWHPFSITSAPGDDYLSVHI---RTLGDWTRKL----------RTVFSEVCKPPTAG---KSGL 705

  Fly   155 YRRFDGLCNNIEHPTWGAANAPFQRLI--GP---------------LYSDGINA-PRISVTGRDL 201
            .|. ||          |..|.||.:::  ||               |...||.| |.||:     
plant   706 LRA-DG----------GDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISI----- 754

  Fly   202 PFSRVVSRTMHPD 214
             ...:::....||
plant   755 -LKDIINNMKGPD 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..699 CDD:460804 18/78 (23%)
RBOHDNP_199602.1 NADPH_Ox 158..256 CDD:462469
EFh <237..283 CDD:238008
EF-hand_7 255..317 CDD:463900
PLN02844 <425..>758 CDD:215453 40/198 (20%)
NOX_Duox_like_FAD_NADP 619..921 CDD:99783 39/198 (20%)
NAD_binding_6 736..903 CDD:429792 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.