DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and AT3G45810

DIOPT Version :10

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_190167.2 Gene:AT3G45810 / 823724 AraportID:AT3G45810 Length:912 Species:Arabidopsis thaliana


Alignment Length:99 Identity:24/99 - (24%)
Similarity:38/99 - (38%) Gaps:39/99 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 EYFMGLMNQVAQAMDDSITQEVTNHLF-----------------KKEGARFGMDLVSFNMQRGRE 572
            |:|.|:|:.:| ..|.:...|:.|:|.                 |.:.|:.|:|:||.:..| ..
plant   792 EWFKGVMDDIA-VYDKTNVIEMHNYLTSMYEAGDARSALIAMVQKLQHAKNGVDIVSESRIR-TH 854

  Fly   573 FGIPGYMEFRK-----------------FCGLPT 589
            |..|.:   ||                 :||.||
plant   855 FARPNW---RKVFSELSNKHETSRIGVFYCGSPT 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..699 CDD:460804 24/99 (24%)
AT3G45810NP_190167.2 NADPH_Ox 107..208 CDD:462469
EF-hand_7 207..270 CDD:463900
COG4097 376..>721 CDD:443273
FAD_binding_8 566..693 CDD:285293
NAD_binding_6 711..894 CDD:429792 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.