DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and cybb

DIOPT Version :9

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_956708.1 Gene:cybb / 393386 ZFINID:ZDB-GENE-040426-1380 Length:565 Species:Danio rerio


Alignment Length:293 Identity:58/293 - (19%)
Similarity:97/293 - (33%) Gaps:114/293 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VAHAQYHQFGEQLQTAHGSDCALLLAGPGRSSVYDYNVNLFRGTLNPYNNGPGTCITYDAINAAY 77
            :.|:::.::|:.:     :||.               |.:|.|  ||                  
Zfish   240 ICHSKFEKWGQNV-----TDCP---------------VPIFAG--NP------------------ 264

  Fly    78 LDARKRIHVAQPKSDWKPEELATVGELLLDISIQLARTYGLSYEEIEKGLPTIDTSKTLIREVCP 142
                       ||: ||    ..||.:.|.:..:|.|.| .|.:::.........||||..::..
Zfish   265 -----------PKT-WK----WVVGPMFLYVCERLVRFY-RSQQKVVITKVVTHPSKTLELQMKK 312

  Fly   143 PFFAGVECRPGKYRRFDGLCNNIEHPTW---GAANAPFQ-------RLIG----PLYS------- 186
               .|.:...|:|  ...:|.:|....|   ...:||.:       |::|    .|||       
Zfish   313 ---KGFKMEVGQY--IFMMCPSISQLEWHPFTLTSAPEEDHFSVHIRIVGDWTQALYSACGGDKT 372

  Fly   187 ---DGINAPRISVTGRDLPFSRVVSRTMHPDDGFHDHAGTVMVIAWGQFMDHDFTLTGTPLDPIN 248
               |....|:::|.|   ||...      .:|.|...|  ||::..|        :..||...:.
Zfish   373 AVLDAWTLPKMAVDG---PFGTA------SEDVFRYEA--VMLVGAG--------IGVTPFASVL 418

  Fly   249 RNDPEECCKRPLHLKHPYCNEIRIPDDDYFYRL 281
            ::         :..||...|:.......|||.|
Zfish   419 KS---------VWYKHVQENQNVFTKKIYFYWL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 32/151 (21%)
peroxinectin_like 305..687 CDD:188655
cybbNP_956708.1 Ferric_reduct 56..216 CDD:280043
NOX_Duox_like_FAD_NADP 295..565 CDD:99783 38/181 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.