DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and Nox3

DIOPT Version :9

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_001004216.1 Gene:Nox3 / 292279 RGDID:1303190 Length:568 Species:Rattus norvegicus


Alignment Length:380 Identity:66/380 - (17%)
Similarity:103/380 - (27%) Gaps:183/380 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLAAVAHAQYHQFG-EQLQTAHGSDCALLLAGPGRSSVYDYNVNLFRGTLNPYNNGPGTCITYD 71
            :::.:|.|...|.|. |:.......|...|||                 .|:...|.|       
  Rat   109 IAVNSVIHIVAHLFNLERYHLGQAKDAEGLLA-----------------ALSKLGNAP------- 149

  Fly    72 AINAAYLDARKRIHVAQPKSDWKPEELATVGELLLDISIQLARTYGLSYEEIEKGLPTIDTSKT- 135
              |.:||:..:.::.            .|..:||:.:|       |::...|...|..|.||.| 
  Rat   150 --NESYLNPVRTLYT------------GTTTQLLMTVS-------GITGLVISLALILIMTSSTE 193

  Fly   136 LIRE--------------------------------------------------------VCP-P 143
            .||:                                                        .|| |
  Rat   194 FIRQSSYELFWYTHHIFIFLFISLAIHGGGRIIRGQTPESLRLHNVTFCRDHFDEWQEAASCPVP 258

  Fly   144 FFAGVECRPGKYRRFDGLCNNIEHPTWGAANAPFQRLIGP--LYSDGINAPRISVTGRDLPFSRV 206
            .|:|.|  |..::             |         .:||  ||:..| ..|...:.:::..::|
  Rat   259 QFSGKE--PSAWK-------------W---------TLGPVVLYACEI-IIRFWRSHQEVVITKV 298

  Fly   207 VSRTMHPDDGFHDH-----------------AGTVMVIAWGQFMDHDFTLTGTPLDPI------- 247
            ||   ||......|                 ..::..:.|     |.||||..|.:..       
  Rat   299 VS---HPSAVLELHMKKRDFKMAPGQYIFIQCPSISPLEW-----HPFTLTSAPQEDFFSVHIRA 355

  Fly   248 --------------NRNDPEECCKRP-LHLKHPYCNEIRIPDDDYFYRLFNVKCI 287
                          ....|.|.|..| |.:..|:...:.    |.|:...:| ||
  Rat   356 SGDWTEALLKAFGAEGQAPSELCSMPRLAVDGPFGGSLA----DVFHYPVSV-CI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 31/174 (18%)
peroxinectin_like 305..687 CDD:188655
Nox3NP_001004216.1 Ferric_reduct 66..217 CDD:280043 28/152 (18%)
NOX_Duox_like_FAD_NADP 295..568 CDD:99783 24/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.