DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and CYBB

DIOPT Version :9

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_000388.2 Gene:CYBB / 1536 HGNCID:2578 Length:570 Species:Homo sapiens


Alignment Length:232 Identity:57/232 - (24%)
Similarity:83/232 - (35%) Gaps:90/232 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DAINAAYLD-ARKRIHVAQPKSDWKPEELATVGELLLDISIQLARTYGLSYEEIEKGLPTIDTS- 133
            |..|.:||: |||||.        .||     |.|.|.::: ||   |::...|...|..|.|| 
Human   146 DRQNESYLNFARKRIK--------NPE-----GGLYLAVTL-LA---GITGVVITLCLILIITSS 193

  Fly   134 -KTLIR----------EVCPPFFAGVECRPGKYRRFDG------LCNNI-----EHPTWG----- 171
             ||:.|          .:...||.|:... |..|...|      ..:||     :...||     
Human   194 TKTIRRSYFEVFWYTHHLFVIFFIGLAIH-GAERIVRGQTAESLAVHNITVCEQKISEWGKIKEC 257

  Fly   172 -----AANAP--FQRLIGPLYSDGINAPRISVTGRDLPFSR-----VVSRTM-HP---------D 214
                 |.|.|  ::.::||::        :.:..|.:.|.|     |:::.: ||         .
Human   258 PIPQFAGNPPMTWKWIVGPMF--------LYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKK 314

  Fly   215 DGFHDHAG--------TVMVIAWGQFMDHDFTLTGTP 243
            .||....|        .|..:.|     |.||||..|
Human   315 KGFKMEVGQYIFVKCPKVSKLEW-----HPFTLTSAP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 28/135 (21%)
peroxinectin_like 305..687 CDD:188655
CYBBNP_000388.2 Ferric_reduct 66..219 CDD:366815 27/89 (30%)
PLN02844 <165..>423 CDD:215453 46/200 (23%)
NOX_Duox_like_FAD_NADP 297..570 CDD:99783 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.