DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cysu and Nox1

DIOPT Version :9

Sequence 1:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_446135.2 Gene:Nox1 / 114243 RGDID:620598 Length:563 Species:Rattus norvegicus


Alignment Length:432 Identity:77/432 - (17%)
Similarity:128/432 - (29%) Gaps:167/432 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LTGVIDANTVYGVKESFARKLRTGYGGLMRMNPVFQEYGLKDLLPLKLDIPDEGCTRPN------ 369
            |.|::...|...:.||..|  ...|.        |.|:          |..:..|..|:      
  Rat   222 LGGIVRGQTEESMSESHPR--NCSYS--------FHEW----------DKYERSCRSPHFVGQPP 266

  Fly   370 ---------KSMYCFEGGEI----RVNEQLVLT--CMHTLMAREHNRLATALAQINKHWDDETLF 419
                     .:.|.||  .|    |..:::|:|  .||.....|        .|:.|        
  Rat   267 ESWKWILAPIAFYIFE--RILRFYRSRQKVVITKVVMHPCKVLE--------LQMRK-------- 313

  Fly   420 QEARRINIAIVQH-------VTFNEFLPILLGKEVMEK-FGLVLQKDGYW--------------- 461
               |...:.|.|:       ::|.|:.|..|.....|: |.:.::..|.|               
  Rat   314 ---RGFTMEIGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSIHIRAAGDWTENLIRTFEQQHSPM 375

  Fly   462 -----DGYDSTVNPGIIDSFAGAAFRFGHSLLPTAV------ERWSKAHKFIASKRLSDLIRRPY 515
                 ||...||:..:...........|..:.|.|.      .::.:||..:.::::..     |
  Rat   376 PRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASFLKSIWYKFQRAHNKLKTQKIYF-----Y 435

  Fly   516 DLYRAGVLDEYFMGLMNQVAQAMDDSITQEVTNHLFKKEGARFGMDLVSFNMQRGREFGIPGYME 580
            .:.|......:|..|:|.:.|.||                                |.|.|.::.
  Rat   436 WICRETGAFAWFNNLLNSLEQEMD--------------------------------ELGKPDFLN 468

  Fly   581 FRKFCGLPTSNTWDEMYGSMPNETVLRYGSIFEHPADI------------DLWSGGVSE--KSLP 631
            :|.|.     ..||   .::.....|.    |:...|:            .:|....|.  .:.|
  Rat   469 YRLFL-----TGWD---SNIAGHAALN----FDRATDVLTGLKQKTSFGRPMWDNEFSRIATAHP 521

  Fly   632 GSMLGPTFACVIATQMSYLRRGDRFWYELPNQPSSFTPEQLQ 673
            .|::| .|.|...|....||:..|.:       ||..|.::|
  Rat   522 KSVVG-VFLCGPPTLAKSLRKCCRRY-------SSLDPRKVQ 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 77/432 (18%)
peroxinectin_like 305..687 CDD:188655 77/432 (18%)
Nox1NP_446135.2 Ferric_reduct 74..217 CDD:396386
NOX_Duox_like_FAD_NADP 296..563 CDD:99783 59/336 (18%)
Interaction with NOXO1. /evidence=ECO:0000250 396..535 30/188 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.