DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14331 and JMJD8

DIOPT Version :9

Sequence 1:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001005920.3 Gene:JMJD8 / 339123 HGNCID:14148 Length:264 Species:Homo sapiens


Alignment Length:236 Identity:60/236 - (25%)
Similarity:90/236 - (38%) Gaps:56/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ENCNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYWYFRDVYTKAKQKQ 155
            |.|       .|.|..:::..||.:::|: ..|||:...|.|    |.|.....||....:...:
Human    41 ERC-------TVERRADLTYAEFVQQYAF-VRPVILQGLTDN----SRFRALCSRDRLLASFGDR 93

  Fly   156 HIRECQFLPYKTGFLDIYDALDMP-EDRVE--LKP------GEQPWYFGWSNCHAETAEEFRRHY 211
            .:|......|.      |..:|:| ::.||  |.|      |....||...|...|.|..| |||
Human    94 VVRLSTANTYS------YHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDNNFTEWASLF-RHY 151

  Fly   212 GRPYFLPEGSENNAVDWFF-IGLSGLGAQMHIDNVRLPSWQAQLAGSKRWLLVPP---PE----- 267
            ..|   |.|....|..:.| |..:|.|...|...   |.:...:.|.|||.|.||   ||     
Human   152 SPP---PFGLLGTAPAYSFGIAGAGSGVPFHWHG---PGYSEVIYGRKRWFLYPPEKTPEFHPNK 210

  Fly   268 ---CYLQ---------CRRFDVVVQQGDIIVLDTNKWYHQT 296
               .:|:         .|..:..::.|:::.. .::|:|.|
Human   211 TTLAWLRDTYPALPPSARPLECTIRAGEVLYF-PDRWWHAT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 46/164 (28%)
JMJD8NP_001005920.3 cupin_like 54..248 CDD:328732 54/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.