DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14331 and CG30053

DIOPT Version :9

Sequence 1:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_725221.1 Gene:CG30053 / 246419 FlyBaseID:FBgn0050053 Length:335 Species:Drosophila melanogaster


Alignment Length:355 Identity:68/355 - (19%)
Similarity:114/355 - (32%) Gaps:120/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FQELLPNFCKGFLFSEK----------W-------VKWIKIVL---------------------L 55
            |:|     |:|..||.|          |       .||..|:|                     |
  Fly     9 FEE-----CRGQGFSAKEMLAVCQPLIWRIRLARIKKWFFILLPLMVIYLLWLCSDTFSWWLSAL 68

  Fly    56 GTLILLGV-------KYYYEEMQGKNCALYLPRNLRYAFRPP---------ENCNFCANIKNVPR 104
            |.|:|:.:       .||:.:     |  .:||:.....:.|         :||:.|..::.:..
  Fly    69 GRLVLIQILPLWDWRPYYHAK-----C--LIPRDQSVQEQAPSLGKAETLRQNCDLCEGLEGIGT 126

  Fly   105 LKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYWYFRDVYTKAKQKQHIRECQFLPYKTGF 169
            :.|:|....|.:......||||:|........||     ...:..|:.|......|.   ..:..
  Fly   127 VSNVSYSSLESEHLERGQPVIITDTGLQTDVFSL-----LEQIEKKSPQWLTSEPCD---VSSNL 183

  Fly   170 L--DIYDALDMPEDRVELKPGE--QPWYFGWSNCHAETAEEFRRHYGRPYFLP------------ 218
            |  .::: |:...|::....|:  ..|:....||..:..:..|....|||:.|            
  Fly   184 LLRKLFN-LEAALDKIHSWQGQTSNSWHLQLRNCQKKAVKSSRLFLDRPYYYPLHLAPYYSSWLL 247

  Fly   219 --EGSENNAVDWFFIGLSGLGAQMHIDNVRLPSWQAQLAGSKRWLLVPPPECYLQ-CRRFDVVVQ 280
              ...:.|..|.:..||..:               .||:|....:|.|...|... |....:.:.
  Fly   248 AVHQQKRNQADIYVRGLVLI---------------QQLSGHFEMVLHPKKPCNKGICPSLRMRLN 297

  Fly   281 QGDIIVLDTNKWYHQTFVQPGAISLTIGAE 310
            .|:.::..|:.|           ||:.|.|
  Fly   298 AGEGLIFTTDIW-----------SLSYGLE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 31/172 (18%)
CG30053NP_725221.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.