DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and NAPSA

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_004842.1 Gene:NAPSA / 9476 HGNCID:13395 Length:420 Species:Homo sapiens


Alignment Length:393 Identity:153/393 - (38%)
Similarity:214/393 - (54%) Gaps:40/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LIRIPMQFQASFMASRRQHRA--GRSSLLAKYNVVGG--QEVTSRNGGATE--------TLDNRL 77
            |||||:            ||.  ||..|    |::.|  :.......||..        .|.|..
Human    26 LIRIPL------------HRVQPGRRIL----NLLRGWREPAELPKLGAPSPGDKPIFVPLSNYR 74

  Fly    78 NLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSI 142
            :::|.|.|.:|:|.|.|.:.|||||:||||||..|...||.|..|||::..|||:|..:|.:|:|
Human    75 DVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAI 139

  Fly   143 AYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLFE 207
            .||||.:.|.|::|.:.||.:...:..||.|..||...|...:|.||:||||..::..|::|..:
Human   140 QYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMD 204

  Fly   208 SMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAG 272
            .:.:|.|:|:.||||||.|:..|..||||:.||.|...:...||:||:|...|||..::.::|..
Human   205 VLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGP 269

  Fly   273 --TRINQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEIVFIIGGQR 335
              |...:...||.||||||:..|..|...:::.:||:|....||::.||||..||.:.|::||..
Human   270 GLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVW 334

  Fly   336 FGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAG----QRRIGF 391
            |.|...|||:..|. :|..:|||.|..:|     ..||||||||:|.|...||.|    ..|:|.
Human   335 FNLTAHDYVIQTTR-NGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGL 398

  Fly   392 APA 394
            |.|
Human   399 ARA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 137/339 (40%)
Asp 80..394 CDD:278455 136/324 (42%)
NAPSANP_004842.1 pepsin_retropepsin_like 72..399 CDD:299705 136/327 (42%)
Asp 77..401 CDD:278455 136/324 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100536
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.