DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and YGL258W-A

DIOPT Version :10

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_076890.1 Gene:YGL258W-A / 852633 SGDID:S000007607 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:15/38 - (39%)
Similarity:21/38 - (55%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHA 258
            |:.|..||.....|.:|||.|||:|::..|...|:..|
Yeast    14 SYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQA 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 Asp 80..394 CDD:394983 15/38 (39%)
YGL258W-ANP_076890.1 pepsin_retropepsin_like <6..>74 CDD:472175 15/38 (39%)

Return to query results.
Submit another query.