DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and YGL258W-A

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_076890.1 Gene:YGL258W-A / 852633 SGDID:S000007607 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:15/38 - (39%)
Similarity:21/38 - (55%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHA 258
            |:.|..||.....|.:|||.|||:|::..|...|:..|
Yeast    14 SYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQA 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 15/38 (39%)
Asp 80..394 CDD:278455 15/38 (39%)
YGL258W-ANP_076890.1 pepsin_retropepsin_like <6..>74 CDD:416259 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.