DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and YPS5

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_011255.1 Gene:YPS5 / 852632 SGDID:S000003228 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:39/178 - (21%)
Similarity:67/178 - (37%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LISLWLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTS---R 65
            |.||..||.:|    .......::.|:|..|..:.                  :|.|:|::   |
Yeast    10 LSSLMCSLTVL----GSSASSYVKFPVQKFADIIN------------------IGTQDVSTVFKR 52

  Fly    66 NGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAE---CSPKSVACHHHHRYNA 127
            |.....|:.|.:.: |...:.||:|.|...:..||||:::.|.:|:   |...|....:....|.
Yeast    53 NEVLNTTVINGIGV-YVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSMSDGSDYASTDNY 116

  Fly   128 SASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATH 175
            ..::||            ||..|...:.:.:.:..|:..|..  ..||
Yeast   117 ELTATF------------TGPRSTTTSPELITLSALIGVNSM--QETH 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 25/108 (23%)
Asp 80..394 CDD:278455 23/99 (23%)
YPS5NP_011255.1 pepsin_retropepsin_like 65..>100 CDD:416259 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.