DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and PGA3

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001073275.1 Gene:PGA3 / 643834 HGNCID:8885 Length:388 Species:Homo sapiens


Alignment Length:398 Identity:153/398 - (38%)
Similarity:228/398 - (57%) Gaps:26/398 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WILCL-FWAKCQGQLIRIPMQFQASFMASRR--QHRAGRSSLLAKYNVVGGQEVTSRNGGAT--- 70
            |:|.| ..|..:..:.::|:..:.|.   ||  ..|......|.|:|:...::...:....|   
Human     3 WLLLLGLVALSECIMYKVPLIRKKSL---RRTLSERGLLKDFLKKHNLNPARKYFPQWKAPTLVD 64

  Fly    71 -ETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFV 134
             :.|:|.|::||.|.|.||:|.|.|.::|||||:||||||..||  |:||.:|:|:|...|||:.
Human    65 EQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCS--SLACTNHNRFNPEDSSTYQ 127

  Fly   135 PDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAE 199
            ......||.|||||::|.|..|||.:|.:...||.||::..|||.......|.||:||.:..|:.
Human   128 STSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISS 192

  Fly   200 LGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFP 264
            .|..|:|:::.:|.||.:.:||.||  :..::.|..::|||:|.:.::|||.:||:|..||||..
Human   193 SGATPVFDNIWNQGLVSQDLFSVYL--SADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQIT 255

  Fly   265 LDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEI 327
            :|.|.:.|..|  .:..|||.|||||||..|......|.|.:|....|:.:.:::||.|.|||:|
Human   256 VDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDI 320

  Fly   328 VFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQR 387
            ||.|.|.::.:.|..|::.:   :||  |:|.|..|:     .|.||||||||.:|:|.||....
Human   321 VFTINGVQYPVPPSAYILQS---EGS--CISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANN 380

  Fly   388 RIGFAPAA 395
            ::|.||.|
Human   381 QVGLAPVA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 137/327 (42%)
Asp 80..394 CDD:278455 135/320 (42%)
PGA3NP_001073275.1 A1_Propeptide 17..45 CDD:285240 6/30 (20%)
pepsin_A 66..386 CDD:133145 137/328 (42%)
Asp 75..387 CDD:278455 135/320 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm8487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.