DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and mgc108380

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:412 Identity:137/412 - (33%)
Similarity:215/412 - (52%) Gaps:54/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WLSLWILCLFWAKCQGQLIRIPMQFQAS-------------FMASRRQHRAGRSSLLAKYNVVGG 59
            |:.|..:||   :....|:|:|::...|             ||.:.::..|.:.....||:....
 Frog     3 WVVLAFICL---QLSEGLVRVPLKRYKSARDIMRERGILKEFMKTHKRDPALKYHFNEKYDFAVA 64

  Fly    60 QEVTSRNGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHR 124
            .|            ...::..|.|.||||:|.|.|.:||||||:||||||..|  :|.||.:|:.
 Frog    65 YE------------PMYMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSC--QSEACSNHNL 115

  Fly   125 YNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGI 189
            :|.|.|||:..:|::||::||:||::|....|||.:..|.:.||.||:...|.|.:|..:.|.||
 Frog   116 FNPSQSSTYTSNGQQFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYSKFDGI 180

  Fly   190 VGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVP 254
            .|:.:..::..|.....:.|..|.|:...:||.|:     ..:.||::|||||...:||.:.:.|
 Frog   181 FGMAYPAMSAGGATTAMQGMLQQNLLTYPIFSVYM-----SSQSGEVIFGGVDNNLYSGQIQWSP 240

  Fly   255 LTHAGYWQFPLDVIEVAGTR---INQNRQAIADTGTSLLAAPPREYL--IINSLLGGLPTSNNEY 314
            :|...|||..:|...:.|..   .:|..|||.|||||.|.. |::|:  ::.:|  |....|..:
 Frog   241 VTQEVYWQIGIDEFLINGQATGWCSQGCQAIVDTGTSPLTI-PQQYMGTLLQNL--GAQNYNGMF 302

  Fly   315 LLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAF--TLMDAE----FWILGDV 373
            ::||:.:.:||.|.|:|.|.:|.:.|..|::. ||    ..|....  |.:.::    .||||||
 Frog   303 VVNCNSVQNLPTITFVINGVQFPIPPSGYIVQ-TN----GYCTVGVEETYLPSQNGQPLWILGDV 362

  Fly   374 FIGRYYTAFDAGQRRIGFAPAA 395
            |:.:||:.:|....|:|||.||
 Frog   363 FLRQYYSVYDMSNNRVGFAQAA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 119/331 (36%)
Asp 80..394 CDD:278455 121/324 (37%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 6/27 (22%)
pepsin_retropepsin_like 71..383 CDD:386101 121/326 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.