DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and Pga5

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_068521.1 Gene:Pga5 / 60372 RGDID:621573 Length:387 Species:Rattus norvegicus


Alignment Length:402 Identity:157/402 - (39%)
Similarity:219/402 - (54%) Gaps:31/402 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WLSLWILCLF-WAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKY-----NVVGGQEVTSRN 66
            |  ||:|.|. .::|   |::||:....|...:.|:... ....|.||     :|:..|.   ||
  Rat     3 W--LWVLGLVALSEC---LVKIPLMKIKSMRENLRESHM-LKDYLEKYPRSRAHVLLEQR---RN 58

  Fly    67 GGAT-ETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASAS 130
            ...| |.:.|.|:|.|.|.||||:|.|.|.::.||||::|||||..||  |.||.||..:|...|
  Rat    59 PSVTYEPMRNYLDLVYIGTISIGTPPQEFKVVLDTGSSDLWVPSIYCS--SPACAHHKVFNPLQS 121

  Fly   131 STFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFR 195
            |||:..||..::|||:|.:||.||.|||.||.|.|..|.||::..|||.......|.||:|||:.
  Rat   122 STFLVSGRPVNVAYGSGEMSGFLAYDTVKIGDLTVVAQAFGLSLEEPGRFMEHAVFDGILGLGYP 186

  Fly   196 PIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGY 260
            .:...|:.|:|:::..|.|:.:.:|:|||  :..:.||..|:.||||.:.:.|.|.:||::...|
  Rat   187 NLGLQGVTPVFDNLWIQGLIPQNLFAFYL--SSKDEKGSVLMLGGVDPSYYHGELHWVPVSKPSY 249

  Fly   261 WQFPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDS 323
            ||..:|.|.:.|..|  :...|.|.||||||:..|....|.|.:|:|...:.:.||.|.|..|::
  Rat   250 WQLAVDSISMNGEIIACDGGCQGIMDTGTSLVTGPRSSILNIQNLIGAKASGDGEYFLKCDTINT 314

  Fly   324 LPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAF-----TLMDAEFWILGDVFIGRYYTAFD 383
            ||:|||.|....:.:....|:    ..|.|..|.|.|     ...|.|.|:|||||:..|:|.||
  Rat   315 LPDIVFTIDSVTYPVPASAYI----RKDHSHNCRSNFEESTDDPSDPELWVLGDVFLRLYFTVFD 375

  Fly   384 AGQRRIGFAPAA 395
            ....|||.|.||
  Rat   376 RANNRIGLASAA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 135/327 (41%)
Asp 80..394 CDD:278455 132/320 (41%)
Pga5NP_068521.1 A1_Propeptide 16..44 CDD:285240 6/28 (21%)
pepsin_retropepsin_like 64..385 CDD:299705 135/328 (41%)
Asp 74..386 CDD:278455 132/319 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.