DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and REN

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens


Alignment Length:401 Identity:132/401 - (32%)
Similarity:203/401 - (50%) Gaps:23/401 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 W-ILCLFWAKCQGQLIRIPMQFQASF---MASRRQHRAGRSSLLAKYNVVGGQ---EVTSRNGGA 69
            | :|.|.|..|...|......|:..|   |.|.|:....|...:|:......|   .:|..|..:
Human    10 WGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTS 74

  Fly    70 TETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFV 134
            :..|.|.::.:|.|.|.||:|.|.|.::|||||:|:||||::||....||.:|..::||.||::.
Human    75 SVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYK 139

  Fly   135 PDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAE 199
            .:|...::.|.||::||.|:||.:.:|.:.| .|.||..|..|...|:...|.|:||:||...|.
Human   140 HNGTELTLRYSTGTVSGFLSQDIITVGGITV-TQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAI 203

  Fly   200 LGIKPLFESMCDQQLVDECVFSFYLKRN--GSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQ 262
            ..:.|:|:::..|.::.|.|||||..|:  .|:..||:::.||.|...:.|:..|:.|...|.||
Human   204 GRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQ 268

  Fly   263 FPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNN--EYLLNCSEIDS 323
            ..:..:.|..:.:  .....|:.|||.|.::.....   |..|:..|.....  :|::.|:|..:
Human   269 IQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSS---IEKLMEALGAKKRLFDYVVKCNEGPT 330

  Fly   324 LPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFD 383
            ||:|.|.:||:.:.|...|||...:. ....:|..|...||     ...|.||..||.::||.||
Human   331 LPDISFHLGGKEYTLTSADYVFQESY-SSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD 394

  Fly   384 AGQRRIGFAPA 394
            ....|||||.|
Human   395 RRNNRIGFALA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 113/331 (34%)
Asp 80..394 CDD:278455 113/324 (35%)
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771 5/17 (29%)
renin_like 78..405 CDD:133154 115/331 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.