DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and pga4

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:401 Identity:162/401 - (40%)
Similarity:223/401 - (55%) Gaps:27/401 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISLWLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLA------KYNVVGGQEVT 63
            :.|.|.|.::.|  ::|   ::::|::...||     ::|..|..||.      .||.......|
 Frog     1 MKLLLLLGLVVL--SEC---VVKVPLRKGESF-----RNRLQRLGLLGDYLKKYPYNPASKYFPT 55

  Fly    64 SRNGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNAS 128
            .....| |.|.|.:::||.|.||||:|.|.|.::||||||||||||..||  |.||.:|:|:|..
 Frog    56 LAQSSA-EVLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYCS--SSACTNHNRFNPQ 117

  Fly   129 ASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLG 193
            .|:||.......||.|||||:||.|..||:.:|.:.:.||.||::..|||.....:.|.||:||.
 Frog   118 QSTTFQATNTPVSIQYGTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSPFDGILGLA 182

  Fly   194 FRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHA 258
            |..||.....|:|::|..|.|:.:.:||.||..:|  :.|..:||||||.:.:||||.:||||..
 Frog   183 FPSIASSQATPVFDNMWSQGLIPQNLFSVYLSSDG--QSGSYVLFGGVDTSYYSGSLNWVPLTAE 245

  Fly   259 GYWQFPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEI 321
            .|||..||.|.:.|..|  :|:.|||.||||||:..|......|...:|....||.:|::||:.|
 Frog   246 TYWQIILDSISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNNI 310

  Fly   322 DSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTL--MDAEFWILGDVFIGRYYTAFDA 384
            .::|.|||.|.|.::.|.|..||..  |..|.|....|.||  ...:.||||||||.:|:..||.
 Frog   311 SNMPTIVFTINGVQYPLPPTAYVRQ--NQQGCSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFDR 373

  Fly   385 GQRRIGFAPAA 395
            ....:..||.|
 Frog   374 TNNYVAMAPVA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 143/324 (44%)
Asp 80..394 CDD:278455 141/317 (44%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 7/32 (22%)
pepsin_A 62..382 CDD:133145 143/325 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.