DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and napsa

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001005701.1 Gene:napsa / 448214 XenbaseID:XB-GENE-947098 Length:402 Species:Xenopus tropicalis


Alignment Length:389 Identity:161/389 - (41%)
Similarity:221/389 - (56%) Gaps:17/389 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRNGGATETLDNRL 77
            :|.|.|.  ...|||||::   .|.:.||.    .|..:.|....|..:...:.....|.|.|.|
 Frog     8 LLLLVWT--TDALIRIPLK---KFPSIRRT----LSDSMTKEEFNGATKEFLKQQTIPEKLTNYL 63

  Fly    78 NLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSI 142
            :.:|.|.|.||:|.|.|.::|||||:||||||.:||....||..|.:|.:..|||:..:...|:|
 Frog    64 DAQYYGEIFIGTPPQKFAVIFDTGSSNLWVPSIKCSFFDFACWLHKKYRSKDSSTYQQNNTEFAI 128

  Fly   143 AYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLFE 207
            .||||||||.|:||||.:|.:.|.||||..|..:||..||..:|.||:|:|:..|:..|:.|:|:
 Frog   129 QYGTGSLSGFLSQDTVTVGSIDVANQTFAEAVKQPGIVFVFAHFDGILGMGYPNISVDGVVPVFD 193

  Fly   208 SMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAG 272
            :|.:|:|::|.||||||.|:.....||||:.||.|...::|...|:.:|...|||...|.:.||.
 Frog   194 NMMEQKLLEENVFSFYLSRDPMAMVGGELVLGGTDPNYYTGDFHYLNVTRMAYWQIKADEVRVAN 258

  Fly   273 TRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEIVFIIGGQR 335
            ..:  ....|||.||||||:..|..|...::..:|..|..:.||.:||..|.|||.:.||:||..
 Frog   259 QLVLCKGGCQAIVDTGTSLITGPREEIRALHKAIGAFPLFSGEYFVNCKRIQSLPTVSFILGGVA 323

  Fly   336 FGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQRRIGFAPA 394
            :.|....||:..:. .|.::|||.|..:|     ...|||||||||:|||.||....|:|||.|
 Frog   324 YNLTGEQYVLKISK-FGHTLCLSGFMGLDIRPPAGPLWILGDVFIGQYYTVFDRDNDRVGFATA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 144/327 (44%)
Asp 80..394 CDD:278455 142/320 (44%)
napsaNP_001005701.1 A1_Propeptide 18..42 CDD:369623 10/30 (33%)
pepsin_retropepsin_like 61..384 CDD:386101 142/323 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.