DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and CG5860

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster


Alignment Length:399 Identity:141/399 - (35%)
Similarity:215/399 - (53%) Gaps:42/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLISLWLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRNG 67
            |.:..:|||    :|..:   :::::|:..:.||..|        ...||:....||        
  Fly     6 CFLLAFLSL----VFATQ---KILKVPLYVRRSFNES--------EVFLARSATEGG-------- 47

  Fly    68 GATETLDNRL------NLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYN 126
               |||..:|      |:||.|.|::|:|.|.|.::|||||:|.|:||..|...:.||.:|.:||
  Fly    48 ---ETLQLQLLLQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYN 109

  Fly   127 ASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVG 191
            :|.||:::||||.|::.||:|.:.|.|::||:.|....:.:.|||.:.......|....|.|:||
  Fly   110 SSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVG 174

  Fly   192 LGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLT 256
            ||...::.....|..|.:|.|:|:::||||.||:|:..     |::|||.|::||.|.|.|||::
  Fly   175 LGLGVLSWSNTTPFLELLCAQRLLEKCVFSVYLRRDPR-----EIVFGGFDESKFEGKLHYVPVS 234

  Fly   257 HAGYWQFPLDVIEVAGTRINQNRQAIADTGTSLLAAPPREY-LIINSLLGGLPTSNNEYLLNCSE 320
            ....|...:....|...:|.....||.||||||:..|.:.| .::|:|...|   .|.|.:...:
  Fly   235 QWHTWSLQISKSSVGTKQIGGKSNAILDTGTSLVLVPQQTYHNLLNTLSAKL---QNGYFVVACK 296

  Fly   321 IDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMDAEFWILGDVFIGRYYTAFDAG 385
            ..|||.|..:||.:.|.|...||:|.... |....|:.|...::..||:|||:|:.||||.|||.
  Fly   297 SGSLPNINILIGDKVFPLTSSDYIMEVLL-DRKPACVLAIAPINRGFWVLGDIFLRRYYTVFDAT 360

  Fly   386 QRRIGFAPA 394
            ::|||.|.|
  Fly   361 EKRIGLAKA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 126/327 (39%)
Asp 80..394 CDD:278455 122/314 (39%)
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 122/315 (39%)
Asp 63..369 CDD:278455 122/314 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439936
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.