DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and ctsd

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_988964.1 Gene:ctsd / 394561 XenbaseID:XB-GENE-5906945 Length:398 Species:Xenopus tropicalis


Alignment Length:404 Identity:162/404 - (40%)
Similarity:231/404 - (57%) Gaps:28/404 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQH--------RAGRSSLLAKYNVVGGQEVT 63
            :|..|.:.|:.  :....|:|||::   .|.:.||..        :...:....||:..    :.
 Frog     6 VWALLALCCVM--QPGSSLVRIPLK---KFTSIRRAMSETDQDALKLSGNEAATKYSAF----LN 61

  Fly    64 SRNGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNAS 128
            |:| ...|||.|.|:.:|.|.|.||:|.|||.::|||||:||||||..||...:||..||:|::|
 Frog    62 SKN-PTPETLLNYLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKYDSS 125

  Fly   129 ASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLG 193
            .|:|::.:|..|:|.||:|||:|.|::|||.||.|.|..|.|..|..:||.|||...|.||:|:|
 Frog   126 KSTTYINNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGILGMG 190

  Fly   194 FRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHA 258
            :..|:..|:.|:|:.:.:|:|||..:|||||.||.....|||||.||.|...::|...|:.:|..
 Frog   191 YPKISVDGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNVTRK 255

  Fly   259 GYWQFPLDVIEVAGTRIN---QNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSE 320
            .|||..:|.:.| |.|::   ...:||.||||||:..|..|...:...:|.:|....||::.|..
 Frog   256 AYWQIHMDQLSV-GDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLICGEYMILCDS 319

  Fly   321 IDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYT 380
            |.|||.|.|..||:.:.|....||:..:. .|.::|||.|..:|     ...||:||||||:|||
 Frog   320 IPSLPVISFTFGGRAYSLTGEQYVLKISK-AGRTVCLSGFLGLDIPPPAGPLWIIGDVFIGQYYT 383

  Fly   381 AFDAGQRRIGFAPA 394
            .||....|:|||.|
 Frog   384 VFDRANDRVGFAKA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 145/328 (44%)
Asp 80..394 CDD:278455 142/321 (44%)
ctsdNP_988964.1 A1_Propeptide 22..>39 CDD:311771 7/19 (37%)
pepsin_retropepsin_like 72..396 CDD:325019 143/325 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.