DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and napsa

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_956325.1 Gene:napsa / 336746 ZFINID:ZDB-GENE-030131-8690 Length:412 Species:Danio rerio


Alignment Length:417 Identity:160/417 - (38%)
Similarity:232/417 - (55%) Gaps:42/417 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGR----------SSLLAKYNVVGGQEVT 63
            |..:::.|..|..|. :||||:.    .|.:.|:..|..          :.:.|||:     :.|
Zfish     6 LFAFLIGLLIADSQA-IIRIPLH----KMRTVRRMLADNGKTIDEIKSLAKMKAKYS-----DGT 60

  Fly    64 SRNGGA--------------TETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSP 114
            ..|.|:              .|.|.|.::.:|.|.||||:|.|.|::||||||:||||||..|:.
Zfish    61 FTNQGSVTIPAPTTTQLPPPVEKLTNFMDAQYYGMISIGTPPQDFSVLFDTGSSNLWVPSIHCAF 125

  Fly   115 KSVACHHHHRYNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGP 179
            ..:||..|.|||:..|||:|.:|..|||.||.|||||.::||||.:..|.|..|.|..|..:||.
Zfish   126 LDIACWLHRRYNSKKSSTYVQNGTEFSIQYGRGSLSGFISQDTVNLAGLNVTGQQFAEAVKQPGI 190

  Fly   180 TFVDTNFAGIVGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKT 244
            .|....|.|::|:.:..|:...:.|:|::....:::.:.:||||:.|:.:...||||:.||.|:.
Zfish   191 VFAVARFDGVLGMAYPAISVDRVTPVFDTAMAAKILPQNIFSFYINRDPAGDVGGELMLGGFDQQ 255

  Fly   245 KFSGSLTYVPLTHAGYWQFPLDVIEVAG--TRINQNRQAIADTGTSLLAAPPREYLIINSLLGGL 307
            .|:|.|.||.:|...|||..:|.::|..  |......|||.|||||::..|.:|...:...:|.:
Zfish   256 YFNGDLHYVNVTRKAYWQIKMDEVQVGSTLTLCKSGCQAIVDTGTSMITGPVQEVRALQKAIGAI 320

  Fly   308 PTSNNEYLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEF 367
            |....||.::|.:|.:||.:.|.:||:.|.|..::|||..:: .|.::|||.|..||     ...
Zfish   321 PLLMGEYWIDCKKIPTLPVVSFSLGGKMFNLTGQEYVMKMSH-MGMNVCLSGFMAMDIPPPAGPL 384

  Fly   368 WILGDVFIGRYYTAFDAGQRRIGFAPA 394
            |||||||||||||.||..|.|:|||||
Zfish   385 WILGDVFIGRYYTVFDRDQDRVGFAPA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 139/327 (43%)
Asp 80..394 CDD:278455 138/320 (43%)
napsaNP_956325.1 A1_Propeptide 21..48 CDD:285240 7/30 (23%)
Cathepsin_D2 86..410 CDD:133157 138/324 (43%)
Asp 91..411 CDD:278455 138/320 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100536
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.