DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and CG31928

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001259869.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:422 Identity:149/422 - (35%)
Similarity:217/422 - (51%) Gaps:50/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LISLWLSLWILCLFWAKCQGQLIRIPMQFQ-----------ASF--MASRRQHRAGRSSLLAKYN 55
            |:.:|      ||..:..:.:..|..:|.:           :||  ...|.:.:...:|.||..:
  Fly    13 LVLIW------CLAQSHVESRRWRKSVQLKLHRETNHTKILSSFHNQKLRLKEKLSPTSDLAISS 71

  Fly    56 VVGGQEVTSRNGGATETLDNRLNLEYAGPISIGSP-GQPFNMLFDTGSANLWVPSAECSPKSVAC 119
            |...|...|:     |.|.|..|.||......|:| .||..:|.||.||||.|.|:|...:|  |
  Fly    72 VSVYQTTVSK-----ENLINSHNTEYYVTAGFGTPKSQPVTLLVDTASANLLVYSSEFVKQS--C 129

  Fly   120 HHHHRYNASASSTFVPDGRRFSIAYGTGS-LSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVD 183
            .||..||:|.|.|:..:|..|.|.:.:.. |:|.|:.||..:|.||::||||......|......
  Fly   130 LHHDGYNSSESQTYQANGSPFQIQFASQEILTGILSTDTFTLGDLVIKNQTFAEINSAPTDMCKR 194

  Fly   184 TNFAGIVGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSE-RKGGELLFGGVDKTKFS 247
            :||.||:||||..||..|::...:::.:|.|:||.:||.|:.||.|: ..||.||.||.|.|.:|
  Fly   195 SNFDGIIGLGFSEIALNGVETPLDNILEQGLIDEPIFSLYVNRNASDASNGGVLLLGGSDPTLYS 259

  Fly   248 GSLTYVPLTHAGYWQFPLDVIEVAGTRINQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNN 312
            |.|||||::..|:||..:..:|:...::..|.|||.|.||||:..|.....|||..||...|...
  Fly   260 GCLTYVPVSKVGFWQITVGQVEIGSKKLCSNCQAIFDMGTSLIIVPCPALKIINKKLGIKETDRK 324

  Fly   313 E--YLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLM----------DA 365
            :  |:::|.::..||:|||.||.:.|.|.|.||:::.     |..|:|.|:.:          |:
  Fly   325 DGVYIIDCKKVSHLPKIVFNIGWKDFTLNPSDYILNY-----SGTCVSGFSSLSDCNGTQTNDDS 384

  Fly   366 E----FWILGDVFIGRYYTAFDAGQRRIGFAP 393
            |    .|:.||||.|..:|.||.|.:.:|.||
  Fly   385 EDLNNIWVFGDVFFGAIFTLFDFGLKLVGMAP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 132/339 (39%)
Asp 80..394 CDD:278455 130/333 (39%)
CG31928NP_001259869.1 pepsin_retropepsin_like 84..416 CDD:299705 131/338 (39%)
Asp 91..416 CDD:278455 128/331 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439957
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.