DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and CG31926

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster


Alignment Length:406 Identity:158/406 - (38%)
Similarity:225/406 - (55%) Gaps:22/406 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LISLWLSLWILCLFWAKCQGQLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRN-- 66
            |:..||::..:..|.|:.: :.:||.:......:....::.....|:....||...:..|..:  
  Fly    10 LLLFWLTVLAVLAFEAEAR-KRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTDTK 73

  Fly    67 --GGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVA-CHHHHRYNAS 128
              |....||:|..|.||...:..|:|.|...:|.|||||||||.|::| |.||| |.:..:||:|
  Fly    74 VPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKC-PDSVAPCANRIKYNSS 137

  Fly   129 ASSTFVPDGRRFSIAYGTGS------LSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFA 187
            ||:|:......|:||||:.|      |||..:||||......::||.|...|:.|...|:.:...
  Fly   138 ASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLD 202

  Fly   188 GIVGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSER-KGGELLFGGVDKTKFSGSLT 251
            ||:||||..||...|.|.|.::..|.||:..|||.||.|||:.. .||||:.||.|...:||.||
  Fly   203 GILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLT 267

  Fly   252 YVPLTHAGYWQFPLDVIEVAGTRINQNRQAIADTGTSLLAAPPREYLIINSLLGGL-PT-SNNEY 314
            |||::.||||||.:....:.|.:..:|.:||.|.||||:..|.:....||.:||.| || ||..:
  Fly   268 YVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVF 332

  Fly   315 LLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMDA-EFWILGDVFIGRY 378
            |::||.|..||:|||.:..::|.|:..|||:...|     .|:|.||.|:. ...|||::|:|.|
  Fly   333 LVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGN-----TCVSGFTSMNGNSLLILGEIFLGAY 392

  Fly   379 YTAFDAGQRRIGFAPA 394
            ||.:|...:.||.|||
  Fly   393 YTTYDIVYKLIGLAPA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 143/331 (43%)
Asp 80..394 CDD:278455 140/324 (43%)
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 142/329 (43%)
Asp 89..408 CDD:278455 140/324 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439951
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D356089at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.