DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and BACE2

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_036237.2 Gene:BACE2 / 25825 HGNCID:934 Length:518 Species:Homo sapiens


Alignment Length:414 Identity:105/414 - (25%)
Similarity:169/414 - (40%) Gaps:114/414 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AGRSSLLAKYNVVGGQEVTSRNGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPS 109
            ||.::.||..:.:.|.   |..|...|.|             ||:|.|...:|.||||:|..|..
Human    72 AGAANFLAMVDNLQGD---SGRGYYLEML-------------IGTPPQKLQILVDTGSSNFAVAG 120

  Fly   110 AECSPKSVACHHHHRYNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMAT 174
               :|.|....:   ::...|||:...|...::.|..||.:|.:.:|.|.|.:....:....:||
Human   121 ---TPHSYIDTY---FDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIAT 179

  Fly   175 HEPGPTFVDTNF-------AGIVGLGFRPIAE--LGIKPLFESMCDQQLVDECVFSFY-----LK 225
                 .|...||       .||:||.:..:|:  ..::..|:|:..|..:.. |||..     |.
Human   180 -----IFESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPN-VFSMQMCGAGLP 238

  Fly   226 RNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAGTRINQN------RQAIAD 284
            ..||...||.|:.||::.:.:.|.:.|.|:....|:|..:..:|:.|..:|.:      .:||.|
Human   239 VAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVD 303

  Fly   285 TGTSLLAAPPREY----------LIINSLLGGLPT-------SNNE-----------YLL--NCS 319
            :||:||..|.:.:          .:|.....|..|       :|:|           ||.  |.|
Human   304 SGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSS 368

  Fly   320 ---EIDSLPEIVF--IIGG------QRFGLQPRDYVMSATNDDGSSICLSAFTLMDAEFWILGDV 373
               .|..||::..  ::|.      .|||:.|      :||    ::.:.| |:|:.        
Human   369 RSFRITILPQLYIQPMMGAGLNYECYRFGISP------STN----ALVIGA-TVMEG-------- 414

  Fly   374 FIGRYYTAFDAGQRRIGFA--PAA 395
                :|..||..|:|:|||  |.|
Human   415 ----FYVIFDRAQKRVGFAASPCA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 94/381 (25%)
Asp 80..394 CDD:278455 94/376 (25%)
BACE2NP_036237.2 beta_secretase_like 89..450 CDD:133140 99/394 (25%)
Asp 92..430 CDD:278455 95/385 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.