DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and Cym

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:337 Identity:137/337 - (40%)
Similarity:194/337 - (57%) Gaps:14/337 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EVTSRNG-GATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHR 124
            |..||.| .|:|.|.|.|:.||.|.|.||:|.|.|.::|||||:.|||||..|:.|  .|.:|||
Mouse    53 EKNSRIGVVASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCNSK--VCRNHHR 115

  Fly   125 YNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGI 189
            ::.|.|.||....:...:.||||.:.|.||.|||.:..:||.:||.|::|.|||..|..:.|.||
Mouse   116 FDPSKSITFQNLSKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDGI 180

  Fly   190 VGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVP 254
            :||.:...|.....|:|::|.::.||.:.:||.|:.||   .:|..|..|.:|::.|.|||.:||
Mouse   181 LGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRN---EQGSMLTLGAIDQSYFIGSLHWVP 242

  Fly   255 LTHAGYWQFPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLN 317
            :|..|||||.:|.|.:.|..:  .....|:.||||:||..|.|:.|.|..::|.:...|:::.::
Mouse   243 VTVQGYWQFTVDRITINGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQGHNDQFDID 307

  Fly   318 CSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMDAEFWILGDVFIGRYYTAF 382
            |..:|.:|.:||.|.|:.|.|.|..|    || .....|.|.|. ..:..||||||||..:|:.|
Mouse   308 CWRLDIMPTVVFEIHGREFPLPPYAY----TN-QVQGFCSSGFK-QGSHMWILGDVFIREFYSVF 366

  Fly   383 DAGQRRIGFAPA 394
            |....|:|.|.|
Mouse   367 DRANNRVGLAKA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 130/322 (40%)
Asp 80..394 CDD:278455 127/315 (40%)
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240
pepsin_retropepsin_like 64..377 CDD:299705 130/323 (40%)
Asp 73..378 CDD:278455 127/315 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1381
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.