DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and Ren2

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_112470.2 Gene:Ren2 / 19702 MGIID:97899 Length:424 Species:Mus musculus


Alignment Length:413 Identity:143/413 - (34%)
Similarity:214/413 - (51%) Gaps:35/413 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WLS--------LWILCLFWAKCQGQL------IRIPMQFQASFMASRRQHRAGRSSLLAKYNVVG 58
            ||:        ||.|.|.|:.|...|      .|||::...|......:.....:.|.|::    
Mouse    20 WLNQMDRRRMPLWALLLLWSPCTFSLPTGTTFERIPLKKMPSVREILEERGVDMTRLSAEW---- 80

  Fly    59 GQEVTSRNGGATE-----TLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVA 118
              :|.::....|:     .|.|.||.:|.|.|.||:|.|.|.::||||||||||||.:||...:|
Mouse    81 --DVFTKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 143

  Fly   119 CHHHHRYNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVD 183
            |..|..|.:|.||:::.:|..|:|.||:|.:.|.|:||:|.:|.:.| .||||..|..|...|:.
Mouse   144 CGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITV-TQTFGEVTELPLIPFML 207

  Fly   184 TNFAGIVGLGFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSG 248
            ..|.|::|:||...|..|:.|:|:.:..|.::.|.|||.|..| |....|||::.||.|...:.|
Mouse   208 AQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNR-GPHLLGGEVVLGGSDPEHYQG 271

  Fly   249 SLTYVPLTHAGYWQFPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSN 311
            ...||.|:....||..:..:.|..:.:  .:..:.:.|||:|.::||.....:|...||......
Mouse   272 DFHYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRL 336

  Fly   312 NEYLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILG 371
            :||:::||::.:||:|.|.:||:.:.|...|||:...| ....:|..|...||     ...|:||
Mouse   337 HEYVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPN-RRDKLCTVALHAMDIPPPTGPVWVLG 400

  Fly   372 DVFIGRYYTAFDAGQRRIGFAPA 394
            ..||.::||.||....|||||.|
Mouse   401 ATFIRKFYTEFDRHNNRIGFALA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 123/332 (37%)
Asp 80..394 CDD:278455 121/320 (38%)
Ren2NP_112470.2 A1_Propeptide 51..76 CDD:285240 4/24 (17%)
renin_like 98..423 CDD:133154 125/327 (38%)
Asp 105..423 CDD:278455 121/320 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.