DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5863 and Ren1

DIOPT Version :9

Sequence 1:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_112469.1 Gene:Ren1 / 19701 MGIID:97898 Length:402 Species:Mus musculus


Alignment Length:404 Identity:144/404 - (35%)
Similarity:211/404 - (52%) Gaps:26/404 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLWILCLFWAKCQGQL-------IRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSR- 65
            :.||.|.|.|:.|...|       .|||::...|......:.....:.|.|::.|     .|.| 
Mouse     6 MPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGV-----FTKRP 65

  Fly    66 ---NGGATETLDNRLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNA 127
               |..:...|.|.||.:|.|.|.||:|.|.|.::||||||||||||.:||...:||..|..|.:
Mouse    66 SLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYES 130

  Fly   128 SASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGL 192
            |.||:::.:|..|:|.||:|.:.|.|:||:|.:|.:.| .||||..|..|...|:...|.|::|:
Mouse   131 SDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITV-TQTFGEVTELPLIPFMLAKFDGVLGM 194

  Fly   193 GFRPIAELGIKPLFESMCDQQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTH 257
            ||...|..|:.|:|:.:..|.::.|.|||.|..| ||...|||::.||.|...:.|:..||.::.
Mouse   195 GFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNR-GSHLLGGEVVLGGSDPQHYQGNFHYVSISK 258

  Fly   258 AGYWQFPLDVIEVAGTRI--NQNRQAIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSE 320
            ...||..:..:.|..:.:  .:....:.|||:|.::||.....:|...||.......||::|||:
Mouse   259 TDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQ 323

  Fly   321 IDSLPEIVFIIGGQRFGLQPRDYVMSATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYT 380
            :.:||:|.|.:||:.:.|...|||:...| ....:|..|...||     ...|:||..||.::||
Mouse   324 VPTLPDISFDLGGRAYTLSSTDYVLQYPN-RRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYT 387

  Fly   381 AFDAGQRRIGFAPA 394
            .||....|||||.|
Mouse   388 EFDRHNNRIGFALA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 124/327 (38%)
Asp 80..394 CDD:278455 122/320 (38%)
Ren1NP_112469.1 A1_Propeptide 29..54 CDD:285240 4/24 (17%)
renin_like 76..401 CDD:133154 126/327 (39%)
Asp 83..401 CDD:278455 122/320 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.